| UniProt ID | MTND2_ARATH | |
|---|---|---|
| UniProt AC | Q8GXE2 | |
| Protein Name | 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 {ECO:0000255|HAMAP-Rule:MF_03154} | |
| Gene Name | ARD2 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 192 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).. | |
| Protein Sequence | MGEAVKDGREEVIQAWYMDDSEEDQRLPHHKDPKEFVSLDKLAELGVLSWRLDADNYETDEDLKKIRESRGYSYMDFCEVCPEKLPNYEVKVKSFFEEHLHTDEEIRYCVAGTGYFDVRDRNEAWIRVLVKKGGMIVLPAGIYHRFTVDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARKEYVDNFMINASA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 57 | Phosphorylation | WRLDADNYETDEDLK EEECCCCCCCHHHHH | 22.28 | 23776212 | |
| 59 | Phosphorylation | LDADNYETDEDLKKI ECCCCCCCHHHHHHH | 34.04 | 23776212 | |
| 147 | Phosphorylation | AGIYHRFTVDSDNYI CCEEEEEEECCCCCE | 24.30 | 28295753 | |
| 150 | Phosphorylation | YHRFTVDSDNYIKAM EEEEEECCCCCEEEE | 24.34 | 28295753 | |
| 153 | Phosphorylation | FTVDSDNYIKAMRLF EEECCCCCEEEEEEC | 14.59 | 28295753 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTND2_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTND2_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTND2_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GBB_ARATH | AGB1 | physical | 21712381 | |
| MTND2_ARATH | ARD1 | physical | 21712381 | |
| Y5010_ARATH | AT5G50100 | physical | 21952135 | |
| MTND4_ARATH | ARD4 | physical | 21952135 | |
| P4H9_ARATH | AT4G33910 | physical | 21952135 | |
| SODF1_ARATH | FSD1 | physical | 21952135 | |
| PER42_ARATH | PRXR1 | physical | 21952135 | |
| RPB7L_ARATH | AT4G14520 | physical | 21952135 | |
| CYSKM_ARATH | OASC | physical | 21952135 | |
| LECT2_ARATH | AT3G15356 | physical | 21952135 | |
| XTH4_ARATH | XTH4 | physical | 21952135 | |
| RBS1A_ARATH | RBCS1A | physical | 21952135 | |
| RL212_ARATH | AT1G57660 | physical | 21952135 | |
| FYPP1_ARATH | AT1G50370 | physical | 21952135 | |
| MYC2_ARATH | MYC2 | physical | 21952135 | |
| NDB3B_ARATH | AT1G14450 | physical | 21952135 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
