UniProt ID | LECT2_ARATH | |
---|---|---|
UniProt AC | Q9LJR2 | |
Protein Name | Lectin-like protein LEC | |
Gene Name | LEC | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 271 | |
Subcellular Localization | Secreted, extracellular space, apoplast . | |
Protein Description | Plays a role in defense responses triggered by jasmonate, ethylene and chitin.. | |
Protein Sequence | MQIHKLCFLALFLANAAFAVKFNFDSFDGSNLLFLGDAELGPSSDGVSRSGALSMTRDETPFSHGQGLYINPIQFKSSNTSSPFDFKTSFTFSITPRTKPNSGQGLAFVIVPAADNSGASGGGYLGILNKTNDGKSENNLIFIEFDTFKNNESNDISGNHVGININSMTSLVAEKAGYWVQTLVGKRKVWSFKDVNLSSGERFKAWIEFRSKDSRNTITIAPENVKKPKRPLIQGSRVLNDVLLQNMYAGFAGSMGRAGERHDVWSWSFEN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
79 | N-linked_Glycosylation | PIQFKSSNTSSPFDF CEEEECCCCCCCCCE | - | ||
129 | N-linked_Glycosylation | GGYLGILNKTNDGKS CCEEEEEECCCCCCC | - | ||
151 | N-linked_Glycosylation | EFDTFKNNESNDISG EEEECCCCCCCCCCC | - | ||
196 | N-linked_Glycosylation | VWSFKDVNLSSGERF EEEEECEECCCCCCE | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LECT2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LECT2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LECT2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LECT2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...