MTND4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MTND4_ARATH
• UniProt AC: Q8H185
• Protein Name: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 4 {ECO:0000255|HAMAP-Rule:MF_03154}
• Gene Name: ARD4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 187
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene)..
• Protein Sequence: MALEAWFMDDSNEDQRLPHHRNPKELVSLDYLAELGVLYWKLNPENYENDSELSKIREDRGYDYMDLLDLCPEKVSNYEEKLKNFFTEHIHKDEEIRYCLAGSGYFDVRDKDDRWIRIWMQPGDLIVLPAGIYHRFTLDASNYIKLMRLFVGEPVWTPYNRPQEEHPVRKKYIHGLTYKFGETVKAH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MALEAWFMD ------CCCEEECCC	17.70	22223895
177	Phosphorylation	KKYIHGLTYKFGETV HHHCCCEEEECCCCC	29.29	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MTND4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MTND4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MTND4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SYP31_ARATH	SYP31	physical	21952135
PRX2E_ARATH	AT3G52960	physical	21952135
AXS1_ARATH	AXS1	physical	21952135
SERK5_ARATH	SERK5	physical	21952135
VOZ1_ARATH	VOZ1	physical	21952135
VAP22_ARATH	VAP27-2	physical	21952135

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.