UniProt ID | MTND4_ARATH | |
---|---|---|
UniProt AC | Q8H185 | |
Protein Name | 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 4 {ECO:0000255|HAMAP-Rule:MF_03154} | |
Gene Name | ARD4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 187 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).. | |
Protein Sequence | MALEAWFMDDSNEDQRLPHHRNPKELVSLDYLAELGVLYWKLNPENYENDSELSKIREDRGYDYMDLLDLCPEKVSNYEEKLKNFFTEHIHKDEEIRYCLAGSGYFDVRDKDDRWIRIWMQPGDLIVLPAGIYHRFTLDASNYIKLMRLFVGEPVWTPYNRPQEEHPVRKKYIHGLTYKFGETVKAH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTND4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTND4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTND4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SYP31_ARATH | SYP31 | physical | 21952135 | |
PRX2E_ARATH | AT3G52960 | physical | 21952135 | |
AXS1_ARATH | AXS1 | physical | 21952135 | |
SERK5_ARATH | SERK5 | physical | 21952135 | |
VOZ1_ARATH | VOZ1 | physical | 21952135 | |
VAP22_ARATH | VAP27-2 | physical | 21952135 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...