dbPTM

PRX2E_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PRX2E_ARATH
UniProt AC	Q949U7
Protein Name	Peroxiredoxin-2E, chloroplastic
Gene Name	PRXIIE
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	234
Subcellular Localization	Plastid, chloroplast stroma .
Protein Description	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides (By similarity). May be involved in chloroplast redox homeostasis (Probable)..
Protein Sequence	MATSLSVSRFMSSSATVISVAKPLLSPTVSFTAPLSFTRSLAPNLSLKFRNRRTNSASATTRSFATTPVTASISVGDKLPDSTLSYLDPSTGDVKTVTVSSLTAGKKTILFAVPGAFTPTCSQKHVPGFVSKAGELRSKGIDVIACISVNDAFVMEAWRKDLGINDEVMLLSDGNGEFTGKLGVELDLRDKPVGLGVRSRRYAILADDGVVKVLNLEEGGAFTNSSAEDMLKAL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
82	Phosphorylation	VGDKLPDSTLSYLDP CCCCCCCCCCCCCCC	29.34	22092075
121	S-nitrosylation	PGAFTPTCSQKHVPG CCCCCCCCCCCCCCC	4.23	22178444
131	Phosphorylation	KHVPGFVSKAGELRS CCCCCCCCCHHHHHH	17.96	25561503
223	Phosphorylation	LEEGGAFTNSSAEDM CCCCCCCCCCCHHHH	33.39	22092075
230	Sulfoxidation	TNSSAEDMLKAL--- CCCCHHHHHHHC---	2.88	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PRX2E_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PRX2E_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PRX2E_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PRX2E_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PRX2E_ARATH

Related Literatures of Post-Translational Modification