dbPTM

Y5010_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	Y5010_ARATH
UniProt AC	Q8W485
Protein Name	Uncharacterized protein At5g50100, chloroplastic
Gene Name	At5g50100
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	214
Subcellular Localization	Plastid, chloroplast .
Protein Description
Protein Sequence	MATRGAVAAAASTIWKHRRNPSLRSLSRHFNPNFNHRIIPTGFKYQVRAIQGTSTDPVITPLKNREEPKPQNWKIKMLYDGDCPLCMREVNMLMERNEKHGTIKFVDISSNDYSPEDNQGLDYKTVMGQIHAIQSDGNVVKGVEAFRRLYEEVGLGWVYTITKFEPIGKLADVVYDVWAKYRLQVTGRPSIEAILEARKKDKVETCGESKNCKI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
60	Phosphorylation	TSTDPVITPLKNREE CCCCCCCCCCCCCCC	23.85	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of Y5010_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of Y5010_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of Y5010_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of Y5010_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of Y5010_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Temporal analysis of sucrose-induced phosphorylation changes inplasma membrane proteins of Arabidopsis."; Niittylae T., Fuglsang A.T., Palmgren M.G., Frommer W.B.,Schulze W.X.; Mol. Cell. Proteomics 6:1711-1726(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-60, AND MASSSPECTROMETRY.	17586839 [Abstract]