SODF1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SODF1_ARATH
• UniProt AC: P21276
• Protein Name: Superoxide dismutase [Fe] 1, chloroplastic
• Gene Name: FSD1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 212
• Subcellular Localization: Cell membrane . Plastid, chloroplast membrane. Plastid, chloroplast stroma.
• Protein Description: Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems..
• Protein Sequence: MAASSAVTANYVLKPPPFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLEHIIHSTYNNGDLLPAFNNAAQAWNHEFFWESMKPGGGGKPSGELLALLERDFTSYEKFYEEFNAAAATQFGAGWAWLAYSNEKLKVVKTPNAVNPLVLGSFPLLTIDVWEHAYYLDFQNRRPDYIKTFMTNLVSWEAVSARLEAAKAASA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAASSAVTA ------CCCCCCEEC		22223895

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SODF1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SODF1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SODF1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SODF3_ARATH	FSD3	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.