dbPTM

XTH4_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	XTH4_ARATH
UniProt AC	Q39099
Protein Name	Xyloglucan endotransglucosylase/hydrolase protein 4
Gene Name	XTH4
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	296
Subcellular Localization	Secreted, cell wall . Secreted, extracellular space, apoplast .
Protein Description	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues..
Protein Sequence	MTVSSSPWALMALFLMVSSTMVMAIPPRKAIDVPFGRNYVPTWAFDHQKQFNGGSELQLILDKYTGTGFQSKGSYLFGHFSMHIKLPAGDTAGVVTAFYLSSTNNEHDEIDFEFLGNRTGQPAILQTNVFTGGKGNREQRIYLWFDPSKAYHTYSILWNMYQIVFFVDNIPIRTFKNAKDLGVRFPFNQPMKLYSSLWNADDWATRGGLEKTNWANAPFVASYKGFHIDGCQASVEAKYCATQGRMWWDQKEFRDLDAEQWRRLKWVRMKWTIYNYCTDRTRFPVMPAECKRDRDA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
117	N-linked_Glycosylation	IDFEFLGNRTGQPAI ECEEECCCCCCCCEE	40.25	10406121
194	Phosphorylation	FNQPMKLYSSLWNAD CCCCCCHHHHCCCHH	7.24	22092075

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of XTH4_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of XTH4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of XTH4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of XTH4_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of XTH4_ARATH

Related Literatures of Post-Translational Modification