UniProt ID | GRAB_HUMAN | |
---|---|---|
UniProt AC | P10144 | |
Protein Name | Granzyme B | |
Gene Name | GZMB | |
Organism | Homo sapiens (Human). | |
Sequence Length | 247 | |
Subcellular Localization | Cytoplasmic granule . Cytoplasmic granules of cytolytic T-lymphocytes and natural killer cells. | |
Protein Description | This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.. | |
Protein Sequence | MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
71 | N-linked_Glycosylation | HCWGSSINVTLGAHN HHHCCCEEEEECCCC | 23.75 | 11325591 | |
104 | N-linked_Glycosylation | HPAYNPKNFSNDIML CCCCCCCCCCCCHHH | 47.00 | 11325591 | |
150 | Phosphorylation | SVAGWGQTAPLGKHS EECCCCCCCCCCCCC | 26.72 | - | |
175 | O-linked_Glycosylation | QEDRKCESDLRHYYD HHHCCCHHHHHHHHH | 51.95 | 29351928 | |
218 | Phosphorylation | KVAQGIVSYGRNNGM CCHHHHHHHCCCCCC | 21.68 | 22210691 | |
219 | Phosphorylation | VAQGIVSYGRNNGMP CHHHHHHHCCCCCCC | 14.81 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GRAB_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GRAB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GRAB_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...