BID_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BID_MOUSE
• UniProt AC: P70444
• Protein Name: BH3-interacting domain death agonist
• Gene Name: Bid
• Organism: Mus musculus (Mouse).
• Sequence Length: 195
• Subcellular Localization: Cytoplasm . Mitochondrion membrane . When uncleaved, it is predominantly cytoplasmic. p15 BID translocates to mitochondria as an integral membrane protein. p13 and p22 BID are associated with the mitochondrial membrane.
• Protein Description: Induces caspases and apoptosis. Counters the protective effect of Bcl-2. The major proteolytic product p15 BID allows the release of cytochrome c..
• Protein Sequence: MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDSEVSNG -------CCCCCCCC	13.28	-
58	Phosphorylation	DLEDELQTDGSQASR CCHHHHCCCCCHHHH	55.76	22817900
61	Phosphorylation	DELQTDGSQASRSFN HHHCCCCCHHHHHHH	25.94	16122426
64	Phosphorylation	QTDGSQASRSFNQGR CCCCCHHHHHHHCCC	22.33	22817900
66	Phosphorylation	DGSQASRSFNQGRIE CCCHHHHHHHCCCCC	26.50	25266776
76	Phosphorylation	QGRIEPDSESQEEII CCCCCCCCCHHHHHH	50.27	28833060
78	Phosphorylation	RIEPDSESQEEIIHN CCCCCCCHHHHHHHH	47.01	23684622
123	Ubiquitination	GSLSEEDKRNCLAKA CCCCHHHHHHHHHHH	49.11	22790023
129	Ubiquitination	DKRNCLAKALDEVKT HHHHHHHHHHHHHHH	36.21	22790023
135	Ubiquitination	AKALDEVKTAFPRDM HHHHHHHHHHCCCCC	31.89	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
58	T	Phosphorylation	Kinase	CSNK2A1	Q60737	GPS
61	S	Phosphorylation	Kinase	CSNK1A1	P48729	GPS
61	S	Phosphorylation	Kinase	KC1A	Q8BK63	PhosphoELM
-	K	Ubiquitination	E3 ubiquitin ligase	Itch	Q8C863	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BID_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BID_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BAX_MOUSE	Bax	physical	17052454
TRAF6_MOUSE	Traf6	physical	27257617

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.