UniProt ID | BID_MOUSE | |
---|---|---|
UniProt AC | P70444 | |
Protein Name | BH3-interacting domain death agonist | |
Gene Name | Bid | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 195 | |
Subcellular Localization | Cytoplasm . Mitochondrion membrane . When uncleaved, it is predominantly cytoplasmic. p15 BID translocates to mitochondria as an integral membrane protein. p13 and p22 BID are associated with the mitochondrial membrane. | |
Protein Description | Induces caspases and apoptosis. Counters the protective effect of Bcl-2. The major proteolytic product p15 BID allows the release of cytochrome c.. | |
Protein Sequence | MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDSEVSNG -------CCCCCCCC | 13.28 | - | |
58 | Phosphorylation | DLEDELQTDGSQASR CCHHHHCCCCCHHHH | 55.76 | 22817900 | |
61 | Phosphorylation | DELQTDGSQASRSFN HHHCCCCCHHHHHHH | 25.94 | 16122426 | |
64 | Phosphorylation | QTDGSQASRSFNQGR CCCCCHHHHHHHCCC | 22.33 | 22817900 | |
66 | Phosphorylation | DGSQASRSFNQGRIE CCCHHHHHHHCCCCC | 26.50 | 25266776 | |
76 | Phosphorylation | QGRIEPDSESQEEII CCCCCCCCCHHHHHH | 50.27 | 28833060 | |
78 | Phosphorylation | RIEPDSESQEEIIHN CCCCCCCHHHHHHHH | 47.01 | 23684622 | |
123 | Ubiquitination | GSLSEEDKRNCLAKA CCCCHHHHHHHHHHH | 49.11 | 22790023 | |
129 | Ubiquitination | DKRNCLAKALDEVKT HHHHHHHHHHHHHHH | 36.21 | 22790023 | |
135 | Ubiquitination | AKALDEVKTAFPRDM HHHHHHHHHHCCCCC | 31.89 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
58 | T | Phosphorylation | Kinase | CSNK2A1 | Q60737 | GPS |
61 | S | Phosphorylation | Kinase | CSNK1A1 | P48729 | GPS |
61 | S | Phosphorylation | Kinase | KC1A | Q8BK63 | PhosphoELM |
- | K | Ubiquitination | E3 ubiquitin ligase | Itch | Q8C863 | PMID:22199232 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BID_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BID_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BAX_MOUSE | Bax | physical | 17052454 | |
TRAF6_MOUSE | Traf6 | physical | 27257617 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...