| UniProt ID | GG_HHV11 | |
|---|---|---|
| UniProt AC | P06484 | |
| Protein Name | Envelope glycoprotein G | |
| Gene Name | gG | |
| Organism | Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1). | |
| Sequence Length | 238 | |
| Subcellular Localization |
Virion membrane Single-pass type I membrane protein . |
|
| Protein Description | Chemokine-binding protein that inhibits neutrophils' chemotaxis.. | |
| Protein Sequence | MSQGAMRAVVPIIPFLLVLVGVSGVPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALDTLFVVSTVIHTLSFLCIGAMATHLCGGWSRRGRRTHPSVRYVCLPSERG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | N-linked_Glycosylation | GVSGVPTNVSSTTQP CCCCCCCCCCCCCCC | 26.13 | UniProtKB CARBOHYD | |
| 49 | N-linked_Glycosylation | RPSHEAPNMTQTGTT CCCCCCCCCCCCCCC | 53.86 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GG_HHV11 !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GG_HHV11 !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GG_HHV11 !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
