| UniProt ID | CSN2_MOUSE | |
|---|---|---|
| UniProt AC | P61202 | |
| Protein Name | COP9 signalosome complex subunit 2 | |
| Gene Name | Cops2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 443 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1.. | |
| Protein Sequence | MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 92 | Phosphorylation | FPEMMNRYKQLLTYI HHHHHHHHHHHHHHH | 9.70 | 18779572 | |
| 97 | Phosphorylation | NRYKQLLTYIRSAVT HHHHHHHHHHHHHHH | 26.04 | 18779572 | |
| 98 | Phosphorylation | RYKQLLTYIRSAVTR HHHHHHHHHHHHHHC | 8.36 | 18779572 | |
| 104 | Phosphorylation | TYIRSAVTRNYSEKS HHHHHHHHCCCCHHH | 16.95 | 18779572 | |
| 179 | S-nitrosocysteine | LRQLHQSCQTDDGED HHHHHHHHCCCCCCC | 3.98 | - | |
| 179 | S-nitrosylation | LRQLHQSCQTDDGED HHHHHHHHCCCCCCC | 3.98 | 20925432 | |
| 181 | Phosphorylation | QLHQSCQTDDGEDDL HHHHHHCCCCCCCHH | 40.14 | 26525534 | |
| 243 | Ubiquitination | VIRECGGKMHLREGE HHHHCCCEEEECCCC | 14.39 | - | |
| 300 | Acetylation | PFDSQEAKPYKNDPE CCCCCCCCCCCCCHH | 48.40 | 23954790 | |
| 331 (in isoform 2) | Ubiquitination | - | 51.24 | 22790023 | |
| 331 | Ubiquitination | TEFEKILKTNHSNIM HHHHHHHHCCCCCCC | 51.24 | 22790023 | |
| 338 (in isoform 2) | Ubiquitination | - | 5.82 | - | |
| 364 | Ubiquitination | QVLIKLIKPYTRIHI HHHHHHHHCCCEEEC | 42.27 | 22790023 | |
| 364 (in isoform 2) | Ubiquitination | - | 42.27 | 22790023 | |
| 371 (in isoform 2) | Ubiquitination | - | 2.51 | - | |
| 415 | Ubiquitination | LLELDHQKRGGARYT HHHHHHHHCCCHHHH | 49.98 | 22790023 | |
| 415 (in isoform 2) | Ubiquitination | - | 49.98 | 22790023 | |
| 422 (in isoform 2) | Ubiquitination | - | 18.39 | - | |
| 426 (in isoform 2) | Ubiquitination | - | 57.69 | 22790023 | |
| 426 | Ubiquitination | ARYTALDKWTNQLNS HHHHHHHHHHHHHHH | 57.69 | 22790023 | |
| 433 (in isoform 2) | Ubiquitination | - | 36.97 | - | |
| 441 | Ubiquitination | LNQAVVSKLA----- HHHHHHHHHC----- | 36.50 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSN2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSN2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSN2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HXD12_MOUSE | Hoxd12 | physical | 20211142 | |
| AXIN1_MOUSE | Axin1 | physical | 19576224 | |
| CTNB1_MOUSE | Ctnnb1 | physical | 19576224 | |
| GSK3B_MOUSE | Gsk3b | physical | 19576224 | |
| LRP6_MOUSE | Lrp6 | physical | 19576224 | |
| CUL1_MOUSE | Cul1 | physical | 19576224 | |
| RBX1_MOUSE | Rbx1 | physical | 19576224 | |
| FBW1A_MOUSE | Btrc | physical | 19576224 | |
| THB_MOUSE | Thrb | physical | 22079090 | |
| NP1L1_MOUSE | Nap1l1 | physical | 17339334 | |
| CSN3_MOUSE | Cops3 | physical | 24973710 | |
| CSN4_MOUSE | Cops4 | physical | 24973710 | |
| CSN5_MOUSE | Cops5 | physical | 24973710 | |
| CSN6_MOUSE | Cops6 | physical | 24973710 | |
| CSN7A_MOUSE | Cops7a | physical | 24973710 | |
| CSN8_MOUSE | Cops8 | physical | 24973710 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
