UniProt ID | HXD12_MOUSE | |
---|---|---|
UniProt AC | P23812 | |
Protein Name | Homeobox protein Hox-D12 | |
Gene Name | Hoxd12 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 268 | |
Subcellular Localization | Nucleus. | |
Protein Description | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.. | |
Protein Sequence | MCERSLYRAGYVGSLLNLQSPDSFYFSNLRANGSQLAALPPISYPRSALPWATTPASCTPAQPATASAFGGFSQPYLTGSGPIGLQSPGAKDGPEDQVKFYTPDAPTASEERSRTRPPFAPESSLVHSALKGTKYDYAGVGRTAPGSATLLQGAPCASSFKEDTKGPLNLNMAVQVAGVASCLRSSLPDGLPWGAAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVQREQALALY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
114 | Dimethylation | TASEERSRTRPPFAP CCCHHHHCCCCCCCC | 40.76 | - | |
114 | Methylation | TASEERSRTRPPFAP CCCHHHHCCCCCCCC | 40.76 | 18964655 | |
240 | Phosphorylation | LSNRLNLSDQQVKIW HHHHCCCCHHHHHHH | 32.09 | 22942356 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HXD12_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HXD12_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HXD12_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PO6F1_MOUSE | Pou6f1 | physical | 20211142 | |
RNPS1_MOUSE | Rnps1 | physical | 20211142 | |
ZN292_MOUSE | Zfp292 | physical | 20211142 | |
RPB9_MOUSE | Polr2i | physical | 20211142 | |
TF2AY_MOUSE | Gtf2a1l | physical | 20211142 | |
TAF13_MOUSE | Taf13 | physical | 20211142 | |
WWP1_MOUSE | Wwp1 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...