PO6F1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PO6F1_MOUSE
• UniProt AC: Q07916
• Protein Name: POU domain, class 6, transcription factor 1
• Gene Name: Pou6f1
• Organism: Mus musculus (Mouse).
• Sequence Length: 301
• Subcellular Localization: Nucleus.
• Protein Description: Transcription factor that binds preferentially to a variant of the octamer motif (5'-ATGATAAT-3')..
• Protein Sequence: MPGISSQILTNAQGQVIGALPWVVNSASVATPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPQPVAVRKPNTPESPAKSEVQPIQPTQAVPQPAVILTSPTPALKPSAATPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLMEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
78	Phosphorylation	RKPNTPESPAKSEVQ CCCCCCCCCCCCCCC	31.21	29899451
239	Phosphorylation	SKKRKRRTSFTPQAI CCCCCCCCCCCHHHH	32.02	19060867
240	Phosphorylation	KKRKRRTSFTPQAIE CCCCCCCCCCHHHHH	25.88	19060867
242	Phosphorylation	RKRRTSFTPQAIEAL CCCCCCCCHHHHHHH	17.79	19060867

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PO6F1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PO6F1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PO6F1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
STAT3_MOUSE	Stat3	physical	20211142
PO6F2_MOUSE	Pou6f2	physical	20211142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.