UniProt ID | CSN5_MOUSE | |
---|---|---|
UniProt AC | O35864 | |
Protein Name | COP9 signalosome complex subunit 5 | |
Gene Name | Cops5 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 334 | |
Subcellular Localization | Cytoplasm, cytosol . Nucleus . Cytoplasm, perinuclear region . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle . Nuclear localization is diminished in the presence of IFIT3. | |
Protein Description | Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. Promotes the proteasomal degradation of BRSK2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. Interacts directly with a large number of proteins that are regulated by the CSN complex, confirming a key role in the complex.. | |
Protein Sequence | MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINVA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAASGSGMA ------CCCCCCCHH | 15.44 | - | |
24 | Phosphorylation | NNMQEAQSIDEIYKY HHHHHHHHHHHHHCC | 38.77 | 29899451 | |
34 | Ubiquitination | EIYKYDKKQQQEILA HHHCCCHHHHHHHHH | 50.90 | 27667366 | |
56 | Ubiquitination | HHYFKYCKISALALL CHHHHHHHHHHHHHH | 36.28 | 22790023 | |
58 | Phosphorylation | YFKYCKISALALLKM HHHHHHHHHHHHHHH | 11.61 | 18779572 | |
203 | Phosphorylation | PDEGPSEYQTIPLNK CCCCCCCCCCEEHHH | 18.46 | 29514104 | |
218 | Glutathionylation | IEDFGVHCKQYYALE CCCCCCCCEEEEEEH | 2.46 | 24333276 | |
284 | Phosphorylation | EAQLGRGSFMLGLET HHHHCCCCHHHCCCC | 13.21 | 25521595 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSN5_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSN5_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSN5_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TERA_MOUSE | Vcp | physical | 19826004 | |
CDN1B_MOUSE | Cdkn1b | physical | 10086358 | |
XPO1_MOUSE | Xpo1 | physical | 11704659 | |
CDN1B_MOUSE | Cdkn1b | physical | 11704659 | |
JUN_MOUSE | Jun | physical | 11704659 | |
CSN4_MOUSE | Cops4 | physical | 11704659 | |
CSN6_MOUSE | Cops6 | physical | 11704659 | |
CSN7B_MOUSE | Cops7b | physical | 11704659 | |
CSN8_MOUSE | Cops8 | physical | 11704659 | |
RANB9_MOUSE | Ranbp9 | physical | 23926111 | |
CDC53_YEAST | CDC53 | physical | 22956996 | |
CUL1_HUMAN | CUL1 | physical | 24973710 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...