CSN5_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CSN5_MOUSE
• UniProt AC: O35864
• Protein Name: COP9 signalosome complex subunit 5
• Gene Name: Cops5
• Organism: Mus musculus (Mouse).
• Sequence Length: 334
• Subcellular Localization: Cytoplasm, cytosol . Nucleus . Cytoplasm, perinuclear region . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle . Nuclear localization is diminished in the presence of IFIT3.
• Protein Description: Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. Promotes the proteasomal degradation of BRSK2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. Interacts directly with a large number of proteins that are regulated by the CSN complex, confirming a key role in the complex..
• Protein Sequence: MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINVA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAASGSGMA ------CCCCCCCHH	15.44	-
24	Phosphorylation	NNMQEAQSIDEIYKY HHHHHHHHHHHHHCC	38.77	29899451
34	Ubiquitination	EIYKYDKKQQQEILA HHHCCCHHHHHHHHH	50.90	27667366
56	Ubiquitination	HHYFKYCKISALALL CHHHHHHHHHHHHHH	36.28	22790023
58	Phosphorylation	YFKYCKISALALLKM HHHHHHHHHHHHHHH	11.61	18779572
203	Phosphorylation	PDEGPSEYQTIPLNK CCCCCCCCCCEEHHH	18.46	29514104
218	Glutathionylation	IEDFGVHCKQYYALE CCCCCCCCEEEEEEH	2.46	24333276
284	Phosphorylation	EAQLGRGSFMLGLET HHHHCCCCHHHCCCC	13.21	25521595

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CSN5_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CSN5_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CSN5_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TERA_MOUSE	Vcp	physical	19826004
CDN1B_MOUSE	Cdkn1b	physical	10086358
XPO1_MOUSE	Xpo1	physical	11704659
CDN1B_MOUSE	Cdkn1b	physical	11704659
JUN_MOUSE	Jun	physical	11704659
CSN4_MOUSE	Cops4	physical	11704659
CSN6_MOUSE	Cops6	physical	11704659
CSN7B_MOUSE	Cops7b	physical	11704659
CSN8_MOUSE	Cops8	physical	11704659
RANB9_MOUSE	Ranbp9	physical	23926111
CDC53_YEAST	CDC53	physical	22956996
CUL1_HUMAN	CUL1	physical	24973710

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.