UniProt ID | CSN7A_MOUSE | |
---|---|---|
UniProt AC | Q9CZ04 | |
Protein Name | COP9 signalosome complex subunit 7a | |
Gene Name | Cops7a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 275 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, JUN, I-kappa-B-alpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively (By similarity).. | |
Protein Sequence | MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTDAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIAQTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPASGTNQRQPSKKASKGKGLRGSAKIWSKSN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSAEVKVTG ------CCCEEEECC | 32.89 | - | |
20 | Ubiquitination | EQFLLLAKSAKGAAL HHHHHHHHHHHHHHH | 51.41 | 22790023 | |
20 (in isoform 2) | Ubiquitination | - | 51.41 | 22790023 | |
113 | Phosphorylation | AKVKCIPYAVLLEAL HHCCHHHHHHHHHHH | 6.88 | - | |
199 | Ubiquitination | VSRANQHKEQQLGLK HHHHHHHHHHHHHHH | 47.67 | 22790023 | |
199 (in isoform 2) | Ubiquitination | - | 47.67 | 22790023 | |
206 (in isoform 2) | Ubiquitination | - | 38.06 | 22790023 | |
206 | Ubiquitination | KEQQLGLKQQIESEV HHHHHHHHHHHHHHH | 38.06 | 22790023 | |
217 | Ubiquitination | ESEVANLKKTIKVTT HHHHHHHHHHHHHHH | 47.91 | 27667366 | |
221 | Ubiquitination | ANLKKTIKVTTAAAA HHHHHHHHHHHHHHH | 38.47 | - | |
223 | Phosphorylation | LKKTIKVTTAAAAAA HHHHHHHHHHHHHHH | 13.00 | 25367039 | |
224 | Phosphorylation | KKTIKVTTAAAAAAT HHHHHHHHHHHHHHH | 19.79 | 25367039 | |
231 | Phosphorylation | TAAAAAATSQDPEQH HHHHHHHHCCCHHHH | 23.38 | 26643407 | |
232 | Phosphorylation | AAAAAATSQDPEQHL HHHHHHHCCCHHHHH | 28.05 | 26643407 | |
233 | Ubiquitination | AAAAATSQDPEQHLT HHHHHHCCCHHHHHH | 66.96 | 27667366 | |
236 | Ubiquitination | AATSQDPEQHLTELR HHHCCCHHHHHHHHH | 59.94 | 27667366 | |
240 | Phosphorylation | QDPEQHLTELREPAS CCHHHHHHHHHCCCC | 30.74 | 26643407 | |
247 | Phosphorylation | TELREPASGTNQRQP HHHHCCCCCCCCCCC | 57.79 | 26643407 | |
249 | Phosphorylation | LREPASGTNQRQPSK HHCCCCCCCCCCCCC | 26.19 | 26643407 | |
255 | Phosphorylation | GTNQRQPSKKASKGK CCCCCCCCCCCCCCC | 38.15 | 26824392 | |
255 (in isoform 2) | Phosphorylation | - | 38.15 | 29514104 | |
257 | Acetylation | NQRQPSKKASKGKGL CCCCCCCCCCCCCCC | 63.33 | 130503 | |
260 | Acetylation | QPSKKASKGKGLRGS CCCCCCCCCCCCCCC | 70.29 | 130507 | |
262 | Acetylation | SKKASKGKGLRGSAK CCCCCCCCCCCCCCH | 59.51 | 7611985 | |
269 | Ubiquitination | KGLRGSAKIWSKSN- CCCCCCCHHHCCCC- | 46.54 | 27667366 | |
274 | Phosphorylation | SAKIWSKSN------ CCHHHCCCC------ | 42.11 | 24759943 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSN7A_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSN7A_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSN7A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CSN7A_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...