| UniProt ID | CBLN4_HUMAN | |
|---|---|---|
| UniProt AC | Q9NTU7 | |
| Protein Name | Cerebellin-4 | |
| Gene Name | CBLN4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 201 | |
| Subcellular Localization | Secreted. Cell junction, synapse. | |
| Protein Description | May be involved in synaptic functions in the CNS. May play a role in CBLN3 export from the endoplasmic reticulum and secretion (By similarity).. | |
| Protein Sequence | MGSGRRALSAVPAVLLVLTLPGLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFPL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 29 | N-linked_Glycosylation | GLPVWAQNDTEPIVL CCCEECCCCCCCEEE | 50.88 | UniProtKB CARBOHYD | |
| 84 | Phosphorylation | RSTNHEPSEMSNKTR CCCCCCCCCCCCCEE | 42.84 | 23090842 | |
| 87 | Phosphorylation | NHEPSEMSNKTRIIY CCCCCCCCCCEEEEE | 30.99 | 23090842 | |
| 88 | N-linked_Glycosylation | HEPSEMSNKTRIIYF CCCCCCCCCEEEEEE | 48.70 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CBLN4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CBLN4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CBLN4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TOPB1_HUMAN | TOPBP1 | physical | 28514442 | |
| NRX3B_HUMAN | NRXN3 | physical | 28514442 | |
| NRX3A_HUMAN | NRXN3 | physical | 28514442 | |
| T2FB_HUMAN | GTF2F2 | physical | 28514442 | |
| KBRS1_HUMAN | NKIRAS1 | physical | 28514442 | |
| NDUF2_HUMAN | NDUFAF2 | physical | 28514442 | |
| DYR2_HUMAN | DHFRL1 | physical | 28514442 | |
| C1QRF_HUMAN | C1QL1 | physical | 28514442 | |
| ADA11_HUMAN | ADAM11 | physical | 28514442 | |
| LRIF1_HUMAN | LRIF1 | physical | 28514442 | |
| GBB2_HUMAN | GNB2 | physical | 28514442 | |
| C1QL4_HUMAN | C1QL4 | physical | 28514442 | |
| FBX2_HUMAN | FBXO2 | physical | 28514442 | |
| KBRS2_HUMAN | NKIRAS2 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
