UniProt ID | APH1A_MOUSE | |
---|---|---|
UniProt AC | Q8BVF7 | |
Protein Name | Gamma-secretase subunit APH-1A | |
Gene Name | Aph1a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 265 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Golgi apparatus, Golgi stack membrane Multi-pass membrane protein . Predominantly located in the endoplasmic reticulum and in the cis-Golgi. |
|
Protein Description | Non-catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). [PubMed: 15634781] | |
Protein Sequence | MGAAVFFGCTFVAFGPAFSLFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLSCRRQEDSRVMVYSALRIPPED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
96 | Ubiquitination | AYYKLLKKADEGLAS HHHHHHHHHHHHHHH | 62.12 | 22790023 | |
251 | Phosphorylation | SCRRQEDSRVMVYSA CCCCCCCCCEEEEEE | 26.48 | 28059163 | |
256 | Phosphorylation | EDSRVMVYSALRIPP CCCCEEEEEEEECCC | 3.10 | 25159016 | |
257 | Phosphorylation | DSRVMVYSALRIPPE CCCEEEEEEEECCCC | 14.93 | 30635358 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of APH1A_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APH1A_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APH1A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PSN1_MOUSE | Psen1 | physical | 15146195 | |
NICA_MOUSE | Ncstn | physical | 15146195 | |
1433Z_MOUSE | Ywhaz | physical | 15146195 | |
1433E_MOUSE | Ywhae | physical | 15146195 | |
AT1A3_MOUSE | Atp1a3 | physical | 15146195 | |
AT1A1_MOUSE | Atp1a1 | physical | 15146195 | |
AT1B1_MOUSE | Atp1b1 | physical | 15146195 | |
MBP_MOUSE | Mbp | physical | 15146195 | |
MYPR_MOUSE | Plp1 | physical | 15146195 | |
GBB1_MOUSE | Gnb1 | physical | 15146195 | |
DPYL2_MOUSE | Dpysl2 | physical | 15146195 | |
PDE10_MOUSE | Pde10a | physical | 15146195 | |
STXB1_MOUSE | Stxbp1 | physical | 15146195 | |
PSN2_MOUSE | Psen2 | physical | 15474363 | |
PSN1_MOUSE | Psen1 | physical | 15474363 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...