| UniProt ID | APH1A_MOUSE | |
|---|---|---|
| UniProt AC | Q8BVF7 | |
| Protein Name | Gamma-secretase subunit APH-1A | |
| Gene Name | Aph1a | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 265 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Golgi apparatus, Golgi stack membrane Multi-pass membrane protein . Predominantly located in the endoplasmic reticulum and in the cis-Golgi. |
|
| Protein Description | Non-catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). [PubMed: 15634781] | |
| Protein Sequence | MGAAVFFGCTFVAFGPAFSLFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLSCRRQEDSRVMVYSALRIPPED | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 96 | Ubiquitination | AYYKLLKKADEGLAS HHHHHHHHHHHHHHH | 62.12 | 22790023 | |
| 251 | Phosphorylation | SCRRQEDSRVMVYSA CCCCCCCCCEEEEEE | 26.48 | 28059163 | |
| 256 | Phosphorylation | EDSRVMVYSALRIPP CCCCEEEEEEEECCC | 3.10 | 25159016 | |
| 257 | Phosphorylation | DSRVMVYSALRIPPE CCCEEEEEEEECCCC | 14.93 | 30635358 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of APH1A_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APH1A_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APH1A_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PSN1_MOUSE | Psen1 | physical | 15146195 | |
| NICA_MOUSE | Ncstn | physical | 15146195 | |
| 1433Z_MOUSE | Ywhaz | physical | 15146195 | |
| 1433E_MOUSE | Ywhae | physical | 15146195 | |
| AT1A3_MOUSE | Atp1a3 | physical | 15146195 | |
| AT1A1_MOUSE | Atp1a1 | physical | 15146195 | |
| AT1B1_MOUSE | Atp1b1 | physical | 15146195 | |
| MBP_MOUSE | Mbp | physical | 15146195 | |
| MYPR_MOUSE | Plp1 | physical | 15146195 | |
| GBB1_MOUSE | Gnb1 | physical | 15146195 | |
| DPYL2_MOUSE | Dpysl2 | physical | 15146195 | |
| PDE10_MOUSE | Pde10a | physical | 15146195 | |
| STXB1_MOUSE | Stxbp1 | physical | 15146195 | |
| PSN2_MOUSE | Psen2 | physical | 15474363 | |
| PSN1_MOUSE | Psen1 | physical | 15474363 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
