| UniProt ID | AP1_ARATH | |
|---|---|---|
| UniProt AC | P35631 | |
| Protein Name | Floral homeotic protein APETALA 1 | |
| Gene Name | AP1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 256 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Is indispensable for normal development of sepals and petals in flowers. Regulates positively the B class homeotic proteins APETALA3 and PISTILLATA with the cooperation of LEAFY and UFO. Interacts with SEPALLATA3 or AP3/PI heterodimer to form complexes that could be involved in genes regulation during floral meristem development. Regulates positively AGAMOUS in cooperation with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Together with AGL24 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Represses flowering time genes AGL24, SVP and SOC1 in emerging floral meristems.. | |
| Protein Sequence | MGRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYSTDSCMEKILERYERYSYAERQLIAPESDVNTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSPKELQNLEQQLDTALKHIRTRKNQLMYESINELQKKEKAIQEQNSMLSKQIKEREKILRAQQEQWDQQNQGHNMPPPLPPQQHQIQHPYMLSHQPSPFLNMGGLYQEDDPMAMRRNDLELTLEPVYNCNLGCFAA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of AP1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AP1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AP1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AP1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SEP3_ARATH | SEP3 | physical | 11206550 | |
| AP1_ARATH | AP1 | physical | 8643482 | |
| PIST_ARATH | PI | physical | 8643482 | |
| AG_ARATH | AG | physical | 8643482 | |
| SEP3_ARATH | SEP3 | physical | 11439126 | |
| SOC1_ARATH | AGL20 | physical | 11439126 | |
| SVP_ARATH | SVP | physical | 11439126 | |
| AGL24_ARATH | AGL24 | physical | 11439126 | |
| AGL27_ARATH | MAF1 | physical | 11439126 | |
| TT16_ARATH | TT16 | physical | 16080001 | |
| AGL24_ARATH | AGL24 | physical | 16679456 | |
| SVP_ARATH | SVP | physical | 16679456 | |
| AGL6_ARATH | AGL6 | physical | 15805477 | |
| SOC1_ARATH | AGL20 | physical | 21798944 | |
| AP1_ARATH | AP1 | physical | 22238427 | |
| SEP3_ARATH | SEP3 | physical | 22238427 | |
| SYD_ARATH | SYD | physical | 22238427 | |
| BRM_ARATH | BRM | physical | 22238427 | |
| INO80_ARATH | INO80 | physical | 22238427 | |
| SEUSS_ARATH | SEU | physical | 22238427 | |
| KNAT3_ARATH | KNAT3 | physical | 22238427 | |
| BLH1_ARATH | BLH1 | physical | 22238427 | |
| BLH9_ARATH | RPL | physical | 22238427 | |
| ARFB_ARATH | ARF2 | physical | 22238427 | |
| CHR4_ARATH | CHR4 | physical | 22238427 | |
| ISW2_ARATH | CHR11 | physical | 22238427 | |
| REF6_ARATH | REF6 | physical | 22238427 | |
| SPL8_ARATH | SPL8 | physical | 22238427 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
