TT16_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TT16_ARATH
• UniProt AC: Q8RYD9
• Protein Name: Protein TRANSPARENT TESTA 16
• Gene Name: TT16
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 252
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation. [PubMed: 12368498]
• Protein Sequence: MGRGKIEIKKIENQTARQVTFSKRRTGLIKKTRELSILCDAHIGLIVFSATGKLSEFCSEQNRMPQLIDRYLHTNGLRLPDHHDDQEQLHHEMELLRRETCNLELRLRPFHGHDLASIPPNELDGLERQLEHSVLKVRERKNELMQQQLENLSRKRRMLEEDNNNMYRWLHEHRAAMEFQQAGIDTKPGEYQQFIEQLQCYKPGEYQQFLEQQQQQPNSVLQLATLPSEIDPTYNLQLAQPNLQNDPTAQND

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TT16_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TT16_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TT16_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TT16_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SEP3_ARATH	SEP3	physical	16080001
TT16_ARATH	TT16	physical	16080001
SEP2_ARATH	SEP2	physical	16080001
SEP1_ARATH	SEP1	physical	16080001
AGL3_ARATH	SEP4	physical	16080001
SEP2_ARATH	SEP2	physical	15805477

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.