| UniProt ID | SEP1_ARATH | |
|---|---|---|
| UniProt AC | P29382 | |
| Protein Name | Developmental protein SEPALLATA 1 | |
| Gene Name | 1-Sep | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 251 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Probable transcription factor. Functions with SEPALLATA2/AGL4 and SEPALLATA3/AGL9 to ensure proper development of petals, stamens and carpels, and to prevent the indeterminate growth of the flower meristem. Forms a heterodimer via the K-box domain with AGAMOUS, that could be involved in genes regulation during floral meristem development.. | |
| Protein Sequence | MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLDRYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGGGGWEGGEQNVTYAHHQAQSQGLYQPLECNPTLQMGYDNPVCSEQITATTQAQAQQGNGYIPGWML | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 135 | Phosphorylation | LERQLDGSLKQVRSI HHHHHHCCHHHHHHH | 31.87 | 24894044 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEP1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEP1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEP1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PIST_ARATH | PI | physical | 12943551 | |
| TT16_ARATH | TT16 | physical | 16080001 | |
| AG_ARATH | AG | physical | 15805477 | |
| AGL1_ARATH | SHP1 | physical | 15805477 | |
| AGL5_ARATH | SHP2 | physical | 15805477 | |
| AGL6_ARATH | AGL6 | physical | 15805477 | |
| AP1_ARATH | AP1 | physical | 15805477 | |
| AGL8_ARATH | AGL8 | physical | 15805477 | |
| AGL11_ARATH | STK | physical | 15805477 | |
| AGL12_ARATH | AGL12 | physical | 15805477 | |
| AGL16_ARATH | AGL16 | physical | 15805477 | |
| SOC1_ARATH | AGL20 | physical | 15805477 | |
| AGL21_ARATH | AGL21 | physical | 15805477 | |
| SVP_ARATH | SVP | physical | 15805477 | |
| AGL24_ARATH | AGL24 | physical | 15805477 | |
| TT16_ARATH | TT16 | physical | 15805477 | |
| AGL8_ARATH | AGL8 | physical | 21798944 | |
| SEP1_ARATH | SEP1 | physical | 25183521 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
