| UniProt ID | AG_ARATH | |
|---|---|---|
| UniProt AC | P17839 | |
| Protein Name | Floral homeotic protein AGAMOUS | |
| Gene Name | AG | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 252 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Probable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms a heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development. Controls AHL21/GIK, a multifunctional chromatin modifier in reproductive organ patterning and differentiation. [PubMed: 19956801 Induces microsporogenesis through the activation of SPL/NZZ] | |
| Protein Sequence | MAYQSELGGDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKREVDLHNDNQILRAKIAENERNNPSISLMPGGSNYEQLMPPPQTQSQPFDSRNYFQVAALQPNNHHYSSAGRQDQTALQLV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of AG_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AG_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AG_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AG_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VSP1_ARATH | VSP1 | physical | 11689012 | |
| SEP3_ARATH | SEP3 | physical | 11206550 | |
| AP1_ARATH | AP1 | physical | 8643482 | |
| AP3_ARATH | AP3 | physical | 8643482 | |
| PIST_ARATH | PI | physical | 8643482 | |
| AG_ARATH | AG | physical | 8643482 | |
| SEP3_ARATH | SEP3 | physical | 14555696 | |
| SEP1_ARATH | SEP1 | physical | 9418042 | |
| SEP2_ARATH | SEP2 | physical | 9418042 | |
| AGL6_ARATH | AGL6 | physical | 9418042 | |
| SEP3_ARATH | SEP3 | physical | 9418042 | |
| SEP2_ARATH | SEP2 | physical | 15805477 | |
| AGL8_ARATH | AGL8 | physical | 15805477 | |
| AGL13_ARATH | AGL13 | physical | 15805477 | |
| AGL16_ARATH | AGL16 | physical | 15805477 | |
| AP3_ARATH | AP3 | physical | 22238427 | |
| PIST_ARATH | PI | physical | 22238427 | |
| SEP3_ARATH | SEP3 | physical | 22238427 | |
| AG_ARATH | AG | physical | 22238427 | |
| AGL1_ARATH | SHP1 | physical | 22238427 | |
| CHR4_ARATH | CHR4 | physical | 22238427 | |
| ISW2_ARATH | CHR11 | physical | 22238427 | |
| REF6_ARATH | REF6 | physical | 22238427 | |
| SPL8_ARATH | SPL8 | physical | 22238427 | |
| AGL13_ARATH | AGL13 | physical | 24164574 | |
| DPOLA_ARATH | ICU2 | genetic | 17873092 | |
| SEP3_ARATH | SEP3 | physical | 17693535 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
