UniProt ID | AP3_ARATH | |
---|---|---|
UniProt AC | P35632 | |
Protein Name | Floral homeotic protein APETALA 3 | |
Gene Name | AP3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 232 | |
Subcellular Localization | Nucleus. | |
Protein Description | Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP.. | |
Protein Sequence | MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISPNTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQELRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLVDNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of AP3_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AP3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AP3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AP3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PIST_ARATH | PI | physical | 12943551 | |
AP1_ARATH | AP1 | physical | 8643482 | |
AP3_ARATH | AP3 | physical | 8643482 | |
PIST_ARATH | PI | physical | 8643482 | |
AG_ARATH | AG | physical | 8643482 | |
AP3_ARATH | AP3 | physical | 22238427 | |
PIST_ARATH | PI | physical | 22238427 | |
SEP3_ARATH | SEP3 | physical | 22238427 | |
CHR4_ARATH | CHR4 | physical | 22238427 | |
ISW2_ARATH | CHR11 | physical | 22238427 | |
AGL13_ARATH | AGL13 | physical | 24164574 | |
AP3_ARATH | AP3 | physical | 14676188 | |
AP3_ARATH | AP3 | physical | 19276203 | |
PIST_ARATH | PI | physical | 19276203 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...