| UniProt ID | AP3_ARATH | |
|---|---|---|
| UniProt AC | P35632 | |
| Protein Name | Floral homeotic protein APETALA 3 | |
| Gene Name | AP3 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 232 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP.. | |
| Protein Sequence | MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISPNTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQELRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLVDNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of AP3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AP3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AP3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AP3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PIST_ARATH | PI | physical | 12943551 | |
| AP1_ARATH | AP1 | physical | 8643482 | |
| AP3_ARATH | AP3 | physical | 8643482 | |
| PIST_ARATH | PI | physical | 8643482 | |
| AG_ARATH | AG | physical | 8643482 | |
| AP3_ARATH | AP3 | physical | 22238427 | |
| PIST_ARATH | PI | physical | 22238427 | |
| SEP3_ARATH | SEP3 | physical | 22238427 | |
| CHR4_ARATH | CHR4 | physical | 22238427 | |
| ISW2_ARATH | CHR11 | physical | 22238427 | |
| AGL13_ARATH | AGL13 | physical | 24164574 | |
| AP3_ARATH | AP3 | physical | 14676188 | |
| AP3_ARATH | AP3 | physical | 19276203 | |
| PIST_ARATH | PI | physical | 19276203 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
