UniProt ID | SEP3_ARATH | |
---|---|---|
UniProt AC | O22456 | |
Protein Name | Developmental protein SEPALLATA 3 | |
Gene Name | 3-Sep | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 251 | |
Subcellular Localization | Nucleus . | |
Protein Description | Probable transcription factor active in inflorescence development and floral organogenesis. Functions with SEPALLATA1/AGL2 and SEPALLATA2/AGL4 to ensure proper development of petals, stamens and carpels and to prevent the indeterminate growth of the flower meristem. Interacts with APETALA1, AGAMOUS or APETALA3/PISTILLATA to form complexes, that could be involved in genes regulation during floral meristem development. [PubMed: 10821278] | |
Protein Sequence | MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQDGMGAGPSVNNYMLGWLPYDTNSI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SEP3_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEP3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEP3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEP3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TT16_ARATH | TT16 | physical | 16080001 | |
AG_ARATH | AG | physical | 15805477 | |
AGL1_ARATH | SHP1 | physical | 15805477 | |
AGL5_ARATH | SHP2 | physical | 15805477 | |
AGL6_ARATH | AGL6 | physical | 15805477 | |
AP1_ARATH | AP1 | physical | 15805477 | |
AGL8_ARATH | AGL8 | physical | 15805477 | |
AGL11_ARATH | STK | physical | 15805477 | |
AGL16_ARATH | AGL16 | physical | 15805477 | |
SOC1_ARATH | AGL20 | physical | 15805477 | |
SVP_ARATH | SVP | physical | 15805477 | |
AGL24_ARATH | AGL24 | physical | 15805477 | |
TT16_ARATH | TT16 | physical | 15805477 | |
AP3_ARATH | AP3 | physical | 22238427 | |
SEP3_ARATH | SEP3 | physical | 22238427 | |
PIST_ARATH | PI | physical | 22238427 | |
AP1_ARATH | AP1 | physical | 22238427 | |
PKL_ARATH | PKL | physical | 22238427 | |
CHR4_ARATH | CHR4 | physical | 22238427 | |
ISW2_ARATH | CHR11 | physical | 22238427 | |
REF6_ARATH | REF6 | physical | 22238427 | |
SEP3_ARATH | SEP3 | physical | 25228343 | |
AG_ARATH | AG | physical | 17693535 | |
AGL1_ARATH | SHP1 | physical | 17693535 | |
AGL5_ARATH | SHP2 | physical | 17693535 | |
AGL11_ARATH | STK | physical | 17693535 | |
SEP3_ARATH | SEP3 | physical | 19276203 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...