UniProt ID | SEP2_ARATH | |
---|---|---|
UniProt AC | P29384 | |
Protein Name | Developmental protein SEPALLATA 2 | |
Gene Name | 2-Sep | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 250 | |
Subcellular Localization | Nucleus. | |
Protein Description | Probable transcription factor. Functions with SEPALLATA1/AGL2 and SEPALLATA3/AGL9 to ensure proper development of petals, stamens and carpels and to prevent the indeterminate growth of the flower meristem. Forms a heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development.. | |
Protein Sequence | MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVRHHHIGGGWEGGDQQNIAYGHPQAHSQGLYQSLECDPTLQIGYSHPVCSEQMAVTVQGQSQQGNGYIPGWML | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
135 | Phosphorylation | LERQLDGSLKQVRCI HHHHHCCCHHHHHHH | 31.87 | 24894044 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEP2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEP2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEP2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AGL16_ARATH | AGL16 | physical | 15805477 | |
SEP2_ARATH | SEP2 | physical | 25183521 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...