SEP2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SEP2_ARATH
• UniProt AC: P29384
• Protein Name: Developmental protein SEPALLATA 2
• Gene Name: 2-Sep
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 250
• Subcellular Localization: Nucleus.
• Protein Description: Probable transcription factor. Functions with SEPALLATA1/AGL2 and SEPALLATA3/AGL9 to ensure proper development of petals, stamens and carpels and to prevent the indeterminate growth of the flower meristem. Forms a heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development..
• Protein Sequence: MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVRHHHIGGGWEGGDQQNIAYGHPQAHSQGLYQSLECDPTLQIGYSHPVCSEQMAVTVQGQSQQGNGYIPGWML

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
135	Phosphorylation	LERQLDGSLKQVRCI HHHHHCCCHHHHHHH	31.87	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SEP2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SEP2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SEP2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AGL16_ARATH	AGL16	physical	15805477
SEP2_ARATH	SEP2	physical	25183521

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.