AGL3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AGL3_ARATH
• UniProt AC: P29383
• Protein Name: Agamous-like MADS-box protein AGL3
• Gene Name: AGL3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 258
• Subcellular Localization: Nucleus.
• Protein Description: Probable transcription factor that binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3'. [PubMed: 7632923]
• Protein Sequence: MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALLIFSNRGKLYEFCSSPSGMARTVDKYRKHSYATMDPNQSAKDLQDKYQDYLKLKSRVEILQHSQRHLLGEELSEMDVNELEHLERQVDASLRQIRSTKARSMLDQLSDLKTKEEMLLETNRDLRRKLEDSDAALTQSFWGSSAAEQQQQHQQQQQGMSSYQSNPPIQEAGFFKPLQGNVALQMSSHYNHNPANATNSATTSQNVNGFFPGWMV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
146	Phosphorylation	IRSTKARSMLDQLSD HHHHHHHHHHHHHHC	28.67	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AGL3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AGL3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AGL3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TT16_ARATH	TT16	physical	16080001
AP1_ARATH	AP1	physical	15805477
AGL8_ARATH	AGL8	physical	15805477
AGL3_ARATH	SEP4	physical	25183521

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.