UniProt ID | YD34B_YEAST | |
---|---|---|
UniProt AC | Q6Q5X2 | |
Protein Name | Cysteine-rich and transmembrane domain-containing protein YDR034W-B | |
Gene Name | YDR034W-B | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 51 | |
Subcellular Localization |
Cytoplasm, cell cortex . Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MRHHQNMHYAPQQQPVYVQQPPPRRESGGCCRTCCHFLCCLCLINLCCDVF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YD34B_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YD34B_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YD34B_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YD34B_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TPO1_YEAST | TPO1 | physical | 18467557 | |
AKR1_YEAST | AKR1 | physical | 18467557 | |
BMT2_YEAST | BMT2 | genetic | 27708008 | |
MBA1_YEAST | MBA1 | genetic | 27708008 | |
ODPB_YEAST | PDB1 | genetic | 27708008 | |
THRC_YEAST | THR4 | genetic | 27708008 | |
BCS1_YEAST | BCS1 | genetic | 27708008 | |
CP56_YEAST | DIT2 | genetic | 27708008 | |
RS27B_YEAST | RPS27B | genetic | 27708008 | |
MRX5_YEAST | YJL147C | genetic | 27708008 | |
RL17B_YEAST | RPL17B | genetic | 27708008 | |
FABG_YEAST | OAR1 | genetic | 27708008 | |
FEN1_YEAST | RAD27 | genetic | 27708008 | |
SAC1_YEAST | SAC1 | genetic | 27708008 | |
YRA2_YEAST | YRA2 | genetic | 27708008 | |
SA190_YEAST | SAP190 | genetic | 27708008 | |
ATP10_YEAST | ATP10 | genetic | 27708008 | |
COX8_YEAST | COX8 | genetic | 27708008 | |
SST2_YEAST | SST2 | genetic | 27708008 | |
MSS1_YEAST | MSS1 | genetic | 27708008 | |
IMP2_YEAST | IMP2 | genetic | 27708008 | |
ODP2_YEAST | LAT1 | genetic | 27708008 | |
YO13A_YEAST | YOL013W-A | genetic | 27708008 | |
LIPA_YEAST | LIP5 | genetic | 27708008 | |
MNE1_YEAST | MNE1 | genetic | 27708008 | |
RAD1_YEAST | RAD1 | genetic | 27708008 | |
MED1_YEAST | MED1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...