| UniProt ID | YD34B_YEAST | |
|---|---|---|
| UniProt AC | Q6Q5X2 | |
| Protein Name | Cysteine-rich and transmembrane domain-containing protein YDR034W-B | |
| Gene Name | YDR034W-B | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 51 | |
| Subcellular Localization |
Cytoplasm, cell cortex . Membrane Single-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MRHHQNMHYAPQQQPVYVQQPPPRRESGGCCRTCCHFLCCLCLINLCCDVF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YD34B_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YD34B_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YD34B_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YD34B_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TPO1_YEAST | TPO1 | physical | 18467557 | |
| AKR1_YEAST | AKR1 | physical | 18467557 | |
| BMT2_YEAST | BMT2 | genetic | 27708008 | |
| MBA1_YEAST | MBA1 | genetic | 27708008 | |
| ODPB_YEAST | PDB1 | genetic | 27708008 | |
| THRC_YEAST | THR4 | genetic | 27708008 | |
| BCS1_YEAST | BCS1 | genetic | 27708008 | |
| CP56_YEAST | DIT2 | genetic | 27708008 | |
| RS27B_YEAST | RPS27B | genetic | 27708008 | |
| MRX5_YEAST | YJL147C | genetic | 27708008 | |
| RL17B_YEAST | RPL17B | genetic | 27708008 | |
| FABG_YEAST | OAR1 | genetic | 27708008 | |
| FEN1_YEAST | RAD27 | genetic | 27708008 | |
| SAC1_YEAST | SAC1 | genetic | 27708008 | |
| YRA2_YEAST | YRA2 | genetic | 27708008 | |
| SA190_YEAST | SAP190 | genetic | 27708008 | |
| ATP10_YEAST | ATP10 | genetic | 27708008 | |
| COX8_YEAST | COX8 | genetic | 27708008 | |
| SST2_YEAST | SST2 | genetic | 27708008 | |
| MSS1_YEAST | MSS1 | genetic | 27708008 | |
| IMP2_YEAST | IMP2 | genetic | 27708008 | |
| ODP2_YEAST | LAT1 | genetic | 27708008 | |
| YO13A_YEAST | YOL013W-A | genetic | 27708008 | |
| LIPA_YEAST | LIP5 | genetic | 27708008 | |
| MNE1_YEAST | MNE1 | genetic | 27708008 | |
| RAD1_YEAST | RAD1 | genetic | 27708008 | |
| MED1_YEAST | MED1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...