UniProt ID | UBTD1_HUMAN | |
---|---|---|
UniProt AC | Q9HAC8 | |
Protein Name | Ubiquitin domain-containing protein 1 | |
Gene Name | UBTD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 227 | |
Subcellular Localization | ||
Protein Description | May be involved in the regulation of cellular senescence through a positive feedback loop with TP53. Is a TP53 downstream target gene that increases the stability of TP53 protein by promoting the ubiquitination and degradation of MDM2.. | |
Protein Sequence | MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
35 | Ubiquitination | PLKKERLKWKSDYPM CCCHHHCCCCCCCCC | 59.81 | 22817900 | |
37 | Ubiquitination | KKERLKWKSDYPMTD CHHHCCCCCCCCCCC | 31.68 | 21890473 | |
40 | Phosphorylation | RLKWKSDYPMTDGQL HCCCCCCCCCCCCCH | 11.29 | - | |
43 | Phosphorylation | WKSDYPMTDGQLRSK CCCCCCCCCCCHHCC | 32.26 | - | |
50 | Ubiquitination | TDGQLRSKRDEFWDT CCCCHHCCCHHHHHC | 58.39 | 23000965 | |
65 | Ubiquitination | APAFEGRKEIWDALK CCCCCCHHHHHHHHH | 65.49 | 23000965 | |
164 | Phosphorylation | TGKDVRLSASLPDTV CCCCEEEECCCCCHH | 12.78 | 30266825 | |
166 | Phosphorylation | KDVRLSASLPDTVGQ CCEEEECCCCCHHHH | 36.74 | 30266825 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBTD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBTD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBTD1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UB2D2_HUMAN | UBE2D2 | physical | 24211586 | |
UB2D3_HUMAN | UBE2D3 | physical | 24211586 | |
UB2D4_HUMAN | UBE2D4 | physical | 24211586 | |
RNF10_HUMAN | RNF10 | physical | 24211586 | |
TEAD1_HUMAN | TEAD1 | physical | 24211586 | |
RBP2_HUMAN | RANBP2 | physical | 24211586 | |
K2026_HUMAN | KIAA2026 | physical | 24211586 | |
PFKAM_HUMAN | PFKM | physical | 24211586 | |
BCOR_HUMAN | BCOR | physical | 24211586 | |
UB2D1_HUMAN | UBE2D1 | physical | 24211586 | |
SHRM3_HUMAN | SHROOM3 | physical | 24211586 | |
MR1L1_HUMAN | MRFAP1L1 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...