UniProt ID | TXD17_HUMAN | |
---|---|---|
UniProt AC | Q9BRA2 | |
Protein Name | Thioredoxin domain-containing protein 17 | |
Gene Name | TXNDC17 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 123 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide.. | |
Protein Sequence | MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MARYEEVSV ------CCCCEEEEC | 23.82 | 19413330 | |
8 | Phosphorylation | MARYEEVSVSGFEEF CCCCEEEECCCHHHH | 17.53 | 25849741 | |
25 | Succinylation | AVEQHNGKTIFAYFT HHHHHCCCEEEEEEE | 43.71 | 23954790 | |
25 | Acetylation | AVEQHNGKTIFAYFT HHHHHCCCEEEEEEE | 43.71 | 26051181 | |
25 | Ubiquitination | AVEQHNGKTIFAYFT HHHHHCCCEEEEEEE | 43.71 | 21890473 | |
26 | Phosphorylation | VEQHNGKTIFAYFTG HHHHCCCEEEEEEEC | 23.79 | 20068231 | |
30 | Phosphorylation | NGKTIFAYFTGSKDA CCCEEEEEEECCCCC | 7.30 | 28152594 | |
32 | Phosphorylation | KTIFAYFTGSKDAGG CEEEEEEECCCCCCC | 28.06 | 28152594 | |
34 | Phosphorylation | IFAYFTGSKDAGGKS EEEEEECCCCCCCCC | 25.06 | 28152594 | |
35 | Ubiquitination | FAYFTGSKDAGGKSW EEEEECCCCCCCCCC | 53.60 | 21890473 | |
35 | Acetylation | FAYFTGSKDAGGKSW EEEEECCCCCCCCCC | 53.60 | 26051181 | |
40 | Acetylation | GSKDAGGKSWCPDCV CCCCCCCCCCCCCCC | 39.61 | 23749302 | |
40 | Ubiquitination | GSKDAGGKSWCPDCV CCCCCCCCCCCCCCC | 39.61 | - | |
46 | Glutathionylation | GKSWCPDCVQAEPVV CCCCCCCCCCCHHHH | 1.15 | 22555962 | |
74 | Acetylation | IYCQVGEKPYWKDPN EEEEECCCCCCCCCC | 37.16 | 27452117 | |
78 | Acetylation | VGEKPYWKDPNNDFR ECCCCCCCCCCCHHH | 58.42 | 23954790 | |
78 | Ubiquitination | VGEKPYWKDPNNDFR ECCCCCCCCCCCHHH | 58.42 | 21906983 | |
89 | Acetylation | NDFRKNLKVTAVPTL CHHHHHCCCCCCCCH | 47.11 | 25953088 | |
89 | Ubiquitination | NDFRKNLKVTAVPTL CHHHHHCCCCCCCCH | 47.11 | 21890473 | |
91 | Phosphorylation | FRKNLKVTAVPTLLK HHHHCCCCCCCCHHH | 21.98 | 23911959 | |
95 | Phosphorylation | LKVTAVPTLLKYGTP CCCCCCCCHHHHCCC | 37.82 | 27067055 | |
98 | Ubiquitination | TAVPTLLKYGTPQKL CCCCCHHHHCCCHHH | 44.75 | 21890473 | |
98 | Acetylation | TAVPTLLKYGTPQKL CCCCCHHHHCCCHHH | 44.75 | 25038526 | |
104 | Ubiquitination | LKYGTPQKLVESECL HHHCCCHHHHHHHHH | 56.56 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TXD17_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TXD17_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TXD17_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
INS_HUMAN | INS | physical | 14607844 | |
NEU1_HUMAN | OXT | physical | 14607844 | |
NEU2_HUMAN | AVP | physical | 14607844 | |
DYL1_HUMAN | DYNLL1 | physical | 14607843 | |
COF1_HUMAN | CFL1 | physical | 14607843 | |
WDR1_HUMAN | WDR1 | physical | 22939629 | |
TYSY_HUMAN | TYMS | physical | 22939629 | |
TXNL1_HUMAN | TXNL1 | physical | 22939629 | |
VINEX_HUMAN | SORBS3 | physical | 22939629 | |
UBP3_HUMAN | USP3 | physical | 22939629 | |
UBE2H_HUMAN | UBE2H | physical | 22939629 | |
UBP5_HUMAN | USP5 | physical | 22939629 | |
UBA3_HUMAN | UBA3 | physical | 22939629 | |
UBE2N_HUMAN | UBE2N | physical | 22939629 | |
UBE2K_HUMAN | UBE2K | physical | 22939629 | |
VATA_HUMAN | ATP6V1A | physical | 22939629 | |
VATC1_HUMAN | ATP6V1C1 | physical | 22939629 | |
WIPI3_HUMAN | WDR45B | physical | 22939629 | |
UPAR_HUMAN | PLAUR | physical | 22939629 | |
NALP5_HUMAN | NLRP5 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-78, AND MASS SPECTROMETRY. |