UniProt ID | TXD12_HUMAN | |
---|---|---|
UniProt AC | O95881 | |
Protein Name | Thioredoxin domain-containing protein 12 | |
Gene Name | TXNDC12 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 172 | |
Subcellular Localization | Endoplasmic reticulum lumen . | |
Protein Description | Possesses significant protein thiol-disulfide oxidase activity.. | |
Protein Sequence | METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
48 | 2-Hydroxyisobutyrylation | RTLEDGKKEAAASGL EECCCCCHHHHHHCC | 59.10 | - | |
64 | Phosphorylation | LMVIIHKSWCGACKA EEEEEEHHHHHHHHH | 17.28 | - | |
70 | Acetylation | KSWCGACKALKPKFA HHHHHHHHHHCHHCC | 57.11 | 26051181 | |
121 | Phosphorylation | RILFLDPSGKVHPEI EEEEECCCCCCCHHH | 51.41 | 21712546 | |
123 | Ubiquitination | LFLDPSGKVHPEIIN EEECCCCCCCHHHCC | 41.53 | 29967540 | |
136 | O-linked_Glycosylation | INENGNPSYKYFYVS CCCCCCCCCEEEEEE | 37.95 | 21740066 | |
165 | Acetylation | LTGDAFRKKHLEDEL HHHHHHHHHHHHHCC | 37.78 | 7683305 | |
166 | Ubiquitination | TGDAFRKKHLEDEL- HHHHHHHHHHHHCC- | 49.52 | 24816145 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TXD12_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TXD12_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TXD12_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TXLNA_HUMAN | TXLNA | physical | 22939629 | |
SGTB_HUMAN | SGTB | physical | 25416956 | |
IQGA2_HUMAN | IQGAP2 | physical | 26344197 | |
GCP4_HUMAN | TUBGCP4 | physical | 28514442 | |
GCP5_HUMAN | TUBGCP5 | physical | 28514442 | |
MZT2A_HUMAN | MZT2A | physical | 28514442 | |
GCP6_HUMAN | TUBGCP6 | physical | 28514442 | |
MZT2B_HUMAN | MZT2B | physical | 28514442 | |
GCP3_HUMAN | TUBGCP3 | physical | 28514442 | |
GCP2_HUMAN | TUBGCP2 | physical | 28514442 | |
NDK7_HUMAN | NME7 | physical | 28514442 | |
TBG1_HUMAN | TUBG1 | physical | 28514442 | |
TM2D3_HUMAN | TM2D3 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...