TNR5_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TNR5_MOUSE
• UniProt AC: P27512
• Protein Name: Tumor necrosis factor receptor superfamily member 5
• Gene Name: Cd40
• Organism: Mus musculus (Mouse).
• Sequence Length: 289
• Subcellular Localization: Isoform I: Cell membrane; Single-pass type I membrane protein.; Isoform III: Cell membrane; Single-pass type I membrane protein.; Isoform IV: Cell membrane; Single-pass type I membrane protein.; Isoform V: Cell membrane; Single-pass type I membrane protei
• Protein Description: Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion..
• Protein Sequence: MVSLPRLCALWGCLLTAVHLGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRALLVIPVVMGILITIFGVFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
153	N-linked_Glycosylation	CPVGFFSNQSSLFEK CCCCCCCCCCHHHHH	40.37	-
244 (in isoform 5)	Phosphorylation	-	50.30	19144319
270	Phosphorylation	TQEDGKESRISVQER CCCCCCEECEEEEEE	38.10	30387612
273	Phosphorylation	DGKESRISVQERQVT CCCEECEEEEEEECC	19.35	19144319

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TNR5_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TNR5_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TNR5_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRAF2_MOUSE	Traf2	physical	18635759
TRAF3_MOUSE	Traf3	physical	18635759
NEMO_MOUSE	Ikbkg	physical	18635759
BIRC2_MOUSE	Birc2	physical	18635759
BIRC3_MOUSE	Birc3	physical	18635759
UBE2N_MOUSE	Ube2n	physical	18635759
MP2K4_MOUSE	Map2k4	physical	18635759
MP2K7_MOUSE	Map2k7	physical	18635759
IKKA_MOUSE	Chuk	physical	18635759
IKKB_MOUSE	Ikbkb	physical	18635759
MK08_MOUSE	Mapk8	physical	18635759
TRAF6_MOUSE	Traf6	physical	18635759
M3K7_MOUSE	Map3k7	physical	18635759
P85A_MOUSE	Pik3r1	physical	11406619
CBL_MOUSE	Cbl	physical	11406619
TRAF6_MOUSE	Traf6	physical	10748240
TRAF2_MOUSE	Traf2	physical	10748240
NEDD4_MOUSE	Nedd4	physical	25072696
TRAF3_MOUSE	Traf3	physical	25072696
TRAF2_MOUSE	Traf2	physical	25072696
ASPP1_MOUSE	Ppp1r13b	physical	25072696

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"The phagosomal proteome in interferon-gamma-activated macrophages.";
Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,Thibault P.;
Immunity 30:143-154(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-273, AND MASSSPECTROMETRY.
PubMed: 19144319