UniProt ID | UBE2N_MOUSE | |
---|---|---|
UniProt AC | P61089 | |
Protein Name | Ubiquitin-conjugating enzyme E2 N | |
Gene Name | Ube2n | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 152 | |
Subcellular Localization | Nucleus . Cytoplasm . | |
Protein Description | The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains. [PubMed: 22424771] | |
Protein Sequence | MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Ubiquitination | GLPRRIIKETQRLLA CCCHHHHHHHHHHHC | 52.95 | - | |
10 | Malonylation | GLPRRIIKETQRLLA CCCHHHHHHHHHHHC | 52.95 | 26320211 | |
10 | Acetylation | GLPRRIIKETQRLLA CCCHHHHHHHHHHHC | 52.95 | 22826441 | |
24 | Ubiquitination | AEPVPGIKAEPDESN CCCCCCCCCCCCCCC | 53.24 | - | |
24 | Acetylation | AEPVPGIKAEPDESN CCCCCCCCCCCCCCC | 53.24 | 23236377 | |
68 | Ubiquitination | EYPMAAPKVRFMTKI CCCCCCCCEEEEECC | 41.12 | - | |
74 | Ubiquitination | PKVRFMTKIYHPNVD CCEEEEECCCCCCHH | 29.49 | - | |
74 | Acetylation | PKVRFMTKIYHPNVD CCEEEEECCCCCCHH | 29.49 | 23236377 | |
82 | Ubiquitination | IYHPNVDKLGRICLD CCCCCHHHHHHHHHH | 48.86 | - | |
82 | Acetylation | IYHPNVDKLGRICLD CCCCCHHHHHHHHHH | 48.86 | 23236377 | |
82 | Malonylation | IYHPNVDKLGRICLD CCCCCHHHHHHHHHH | 48.86 | 26320211 | |
87 | S-nitrosocysteine | VDKLGRICLDILKDK HHHHHHHHHHHHCCC | 2.42 | - | |
87 | Glutathionylation | VDKLGRICLDILKDK HHHHHHHHHHHHCCC | 2.42 | 24333276 | |
87 | S-nitrosylation | VDKLGRICLDILKDK HHHHHHHHHHHHCCC | 2.42 | 19101475 | |
92 | Ubiquitination | RICLDILKDKWSPAL HHHHHHHCCCCCHHH | 58.56 | - | |
94 | Ubiquitination | CLDILKDKWSPALQI HHHHHCCCCCHHHHH | 48.24 | - | |
94 | Acetylation | CLDILKDKWSPALQI HHHHHCCCCCHHHHH | 48.24 | 23806337 | |
94 | Succinylation | CLDILKDKWSPALQI HHHHHCCCCCHHHHH | 48.24 | 23806337 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBE2N_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBE2N_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBE2N_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UB2V2_HUMAN | UBE2V2 | physical | 12039045 | |
TNAP3_MOUSE | Tnfaip3 | physical | 20185725 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...