| UniProt ID | TMA7_YEAST | |
|---|---|---|
| UniProt AC | Q3E764 | |
| Protein Name | Translation machinery-associated protein 7 | |
| Gene Name | TMA7 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 64 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Involved in protein synthesis.. | |
| Protein Sequence | MSSRQGGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKSGKPLVGGGIKKSGKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Acetylation | MSSRQGGKMKPLKQK CCCCCCCCCCCHHHH | 51.04 | 25381059 | |
| 10 | Acetylation | SRQGGKMKPLKQKKK CCCCCCCCCHHHHHH | 51.16 | 25381059 | |
| 16 | Acetylation | MKPLKQKKKQQQDLD CCCHHHHHHHHCCCC | 54.01 | 24489116 | |
| 17 | Ubiquitination | KPLKQKKKQQQDLDP CCHHHHHHHHCCCCH | 61.45 | 23749301 | |
| 30 | Ubiquitination | DPEDIAFKEKQKADA CHHHHHHHHHHHHHH | 55.79 | 23749301 | |
| 30 | Acetylation | DPEDIAFKEKQKADA CHHHHHHHHHHHHHH | 55.79 | 24489116 | |
| 32 | Acetylation | EDIAFKEKQKADAAA HHHHHHHHHHHHHHH | 58.66 | 24489116 | |
| 41 | Acetylation | KADAAAKKALMANMK HHHHHHHHHHHHHCC | 41.86 | 25381059 | |
| 48 | Ubiquitination | KALMANMKSGKPLVG HHHHHHCCCCCCCCC | 56.73 | 22817900 | |
| 48 | Acetylation | KALMANMKSGKPLVG HHHHHHCCCCCCCCC | 56.73 | 25381059 | |
| 49 | Phosphorylation | ALMANMKSGKPLVGG HHHHHCCCCCCCCCC | 41.08 | 21440633 | |
| 51 | Ubiquitination | MANMKSGKPLVGGGI HHHCCCCCCCCCCCC | 42.12 | 23749301 | |
| 59 | Acetylation | PLVGGGIKKSGKK-- CCCCCCCCCCCCC-- | 44.13 | 25381059 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMA7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMA7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMA7_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...