ST1E1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ST1E1_HUMAN
• UniProt AC: P49888
• Protein Name: Estrogen sulfotransferase
• Gene Name: SULT1E1
• Organism: Homo sapiens (Human).
• Sequence Length: 294
• Subcellular Localization: Cytoplasm.
• Protein Description: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of estradiol and estrone. May play a role in the regulation of estrogen receptor activity by metabolizing free estradiol. Maximally sulfates beta-estradiol and estrone at concentrations of 20 nM. Also sulfates dehydroepiandrosterone, pregnenolone, ethinylestradiol, equalenin, diethylstilbesterol and 1-naphthol, at significantly higher concentrations; however, cortisol, testosterone and dopamine are not sulfated..
• Protein Sequence: MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
48	Phosphorylation	VIATYPKSGTTWVSE EEEEECCCCCCCHHH	36.55	21955146
50	Phosphorylation	ATYPKSGTTWVSEIV EEECCCCCCCHHHHH	25.28	21955146
51	Phosphorylation	TYPKSGTTWVSEIVY EECCCCCCCHHHHHH	27.65	21955146
54	Phosphorylation	KSGTTWVSEIVYMIY CCCCCCHHHHHHHHH	17.11	21955146
83	Glutathionylation	NRIPFLECRKENLMN HCCCHHHHHHHHHHH	9.06	22833525
192	Phosphorylation	PRVLFLFYEDLKEDI CEEEEEEEHHHHHHH	15.64	-
205	Acetylation	DIRKEVIKLIHFLER HHHHHHHHHHHHHHC	46.71	20167786

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ST1E1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ST1E1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ST1E1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ENOX1_HUMAN	ENOX1	physical	16189514
ST2B1_HUMAN	SULT2B1	physical	16189514
ERG28_HUMAN	C14orf1	physical	16169070
CSN6_HUMAN	COPS6	physical	16169070
RBM48_HUMAN	RBM48	physical	16169070
IGS21_HUMAN	IGSF21	physical	16169070
EF1A1_HUMAN	EEF1A1	physical	16169070
LRIF1_HUMAN	LRIF1	physical	16169070
SETB1_HUMAN	SETDB1	physical	16169070
P53_HUMAN	TP53	physical	16169070
U119A_HUMAN	UNC119	physical	16169070
GDE_HUMAN	AGL	physical	26344197
GLPK_HUMAN	GK	physical	26344197

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• DB00316: Acetaminophen
• DB01176: Cyclizine