UniProt ID | SEGN_HUMAN | |
---|---|---|
UniProt AC | O76038 | |
Protein Name | Secretagogin | |
Gene Name | SCGN | |
Organism | Homo sapiens (Human). | |
Sequence Length | 276 | |
Subcellular Localization |
Cytoplasm. Secreted. Cytoplasmic vesicle, secretory vesicle membrane Peripheral membrane protein Cytoplasmic side. Predominantly cytoplasmic. A small proportion is associated with secretory granules and membrane fractions (By similarity). Detectabl |
|
Protein Description | ||
Protein Sequence | MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
146 | Phosphorylation | LHHKKAISEAKLEEY HHHHHHHCHHHHHHH | 36.04 | 22798277 | |
153 | Phosphorylation | SEAKLEEYTGTMMKI CHHHHHHHHCCCHHH | 10.90 | - | |
154 | Phosphorylation | EAKLEEYTGTMMKIF HHHHHHHHCCCHHHH | 29.47 | - | |
156 | Phosphorylation | KLEEYTGTMMKIFDR HHHHHHCCCHHHHCC | 13.29 | - | |
208 | Phosphorylation | DFEKIFAYYDVSKTG HHHHHHHHEECCCCC | 6.88 | 19835603 | |
209 | Phosphorylation | FEKIFAYYDVSKTGA HHHHHHHEECCCCCC | 13.36 | 19835603 | |
236 | Phosphorylation | MMELVQPSISGVDLD HHHHHCCCCCCCCHH | 16.58 | 27251275 | |
238 | Phosphorylation | ELVQPSISGVDLDKF HHHCCCCCCCCHHHH | 36.78 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEGN_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEGN_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEGN_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...