dbPTM

RU17_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RU17_SCHPO
UniProt AC	O13829
Protein Name	U1 small nuclear ribonucleoprotein 70 kDa homolog
Gene Name	usp101 {ECO:0000312\|EMBL:CAB11649.1}
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	261
Subcellular Localization	Nucleus .
Protein Description	Involved in nuclear mRNA splicing (By similarity). Essential for growth..
Protein Sequence	MAEKLPAPLLALFAPRPPLRYLPPMDVPPEKRSTPRVSGIAKYLKYAQSHDQQYHPTESLEEKRLRLRDEKQKQQRERLRSMIKVWDPDHDRHVIGDPYKTMFLSRLSYDTKESDIEREFTRYGPIERIRVVRNKVTGKSMGYAFVVFERERDLKVAYKASAGLMLNGRRIVVDVERGRTVKGWLPRKLGGGLGGRHYTKERPRRERGSRFRGDSGFRGGYRGGFRKSSGGGSRFGRGPTRSSHSSDYGGRDSSPKRRRYN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
253	Phosphorylation	SDYGGRDSSPKRRRY CCCCCCCCCCCCCCC	47.37	29996109
254	Phosphorylation	DYGGRDSSPKRRRYN CCCCCCCCCCCCCCC	38.44	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RU17_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RU17_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RU17_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RU17_SCHPO	usp101	physical	17264129
RU1A_SCHPO	usp102	physical	17264129
RU1C_SCHPO	usp103	physical	17264129
PRP40_SCHPO	usp104	physical	17264129
PRP39_SCHPO	usp105	physical	17264129
LUC7_SCHPO	luc7	physical	17264129
US108_SCHPO	usp108	physical	17264129
US109_SCHPO	usp109	physical	17264129
RSMB_SCHPO	smb1	physical	17264129
SMD1_SCHPO	smd1	physical	17264129
SMD2_SCHPO	smd2	physical	17264129
SMD3_SCHPO	smd3	physical	17264129
RUXE_SCHPO	sme1	physical	17264129
RUXF_SCHPO	smf1	physical	17264129
RUXG_SCHPO	smg1	physical	17264129
US107_SCHPO	usp107	physical	17264129
CSN3_SCHPO	csn3	genetic	22681890
GOS1_SCHPO	gos1	genetic	22681890
VPS38_SCHPO	vps38	genetic	22681890
POF3_SCHPO	pof3	genetic	22681890
YGNB_SCHPO	nap2	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RU17_SCHPO

Related Literatures of Post-Translational Modification