UniProt ID | RU17_SCHPO | |
---|---|---|
UniProt AC | O13829 | |
Protein Name | U1 small nuclear ribonucleoprotein 70 kDa homolog | |
Gene Name | usp101 {ECO:0000312|EMBL:CAB11649.1} | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 261 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in nuclear mRNA splicing (By similarity). Essential for growth.. | |
Protein Sequence | MAEKLPAPLLALFAPRPPLRYLPPMDVPPEKRSTPRVSGIAKYLKYAQSHDQQYHPTESLEEKRLRLRDEKQKQQRERLRSMIKVWDPDHDRHVIGDPYKTMFLSRLSYDTKESDIEREFTRYGPIERIRVVRNKVTGKSMGYAFVVFERERDLKVAYKASAGLMLNGRRIVVDVERGRTVKGWLPRKLGGGLGGRHYTKERPRRERGSRFRGDSGFRGGYRGGFRKSSGGGSRFGRGPTRSSHSSDYGGRDSSPKRRRYN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RU17_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RU17_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RU17_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RU17_SCHPO | usp101 | physical | 17264129 | |
RU1A_SCHPO | usp102 | physical | 17264129 | |
RU1C_SCHPO | usp103 | physical | 17264129 | |
PRP40_SCHPO | usp104 | physical | 17264129 | |
PRP39_SCHPO | usp105 | physical | 17264129 | |
LUC7_SCHPO | luc7 | physical | 17264129 | |
US108_SCHPO | usp108 | physical | 17264129 | |
US109_SCHPO | usp109 | physical | 17264129 | |
RSMB_SCHPO | smb1 | physical | 17264129 | |
SMD1_SCHPO | smd1 | physical | 17264129 | |
SMD2_SCHPO | smd2 | physical | 17264129 | |
SMD3_SCHPO | smd3 | physical | 17264129 | |
RUXE_SCHPO | sme1 | physical | 17264129 | |
RUXF_SCHPO | smf1 | physical | 17264129 | |
RUXG_SCHPO | smg1 | physical | 17264129 | |
US107_SCHPO | usp107 | physical | 17264129 | |
CSN3_SCHPO | csn3 | genetic | 22681890 | |
GOS1_SCHPO | gos1 | genetic | 22681890 | |
VPS38_SCHPO | vps38 | genetic | 22681890 | |
POF3_SCHPO | pof3 | genetic | 22681890 | |
YGNB_SCHPO | nap2 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...