US108_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: US108_SCHPO
• UniProt AC: Q09848
• Protein Name: U1 snRNP-associated protein usp108
• Gene Name: usp108
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 337
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Component of the U1 snRNP particle, which recognizes and binds the 5'-splice site of pre-mRNA. Together with other non-snRNP factors, U1 snRNP forms the spliceosomal commitment complex, that targets pre-mRNA to the splicing pathway..
• Protein Sequence: MDSGTSVVSISADILRPPVLTAAQTFGDNENECRVRLVLTAQQVQEWNLLPQDIQQEILKNGQVRVETYSSSNTARKIFICTSSVSNLASSIPALIKVVTPTKEEDASLNINLAVSSLILGSKVLIHQNLIPSLFSVSNSTKLLYSASLLPRSSERLVTLETNEIDASVVIETLLKYILSRISFIPRVSVVPYIPDAAYGIYGSPSTFTQFNHMSSMVTPENPYGIPPIALTSAGGNPDPLRTTQVFPHSGPSIPLNIAATQVVSQKMSVPSSLLDQLYHAMPHKLMEISQNTNANITVEESDSNSNEKFISVVGTSEANQSALMQLYAALISLGRK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
72	Phosphorylation	RVETYSSSNTARKIF EEEEECCCCCCEEEE		29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of US108_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of US108_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of US108_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRP39_SCHPO	usp105	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.