UniProt ID | RU1C_SCHPO | |
---|---|---|
UniProt AC | Q9P794 | |
Protein Name | U1 small nuclear ribonucleoprotein C {ECO:0000255|HAMAP-Rule:MF_03153} | |
Gene Name | usp103 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 182 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. usp103/U1-C is directly involved in initial 5' splice-site recognition for both constitutive and regulated alternative splicing. The interaction with the 5' splice-site seems to precede base-pairing between the pre-mRNA and the U1 snRNA. Stimulates commitment or early (E) complex formation by stabilizing the base pairing of the 5' end of the U1 snRNA and the 5' splice-site region.. | |
Protein Sequence | MPRYLCDYCQVWLTHDSQSVRKAHNAGRAHIQNVQDYYTKVAQEEAQKQLEERASSGFLKKGNGSLDLPYAYAFPPKYNVFNLGCPPPPYIVSANTYMAPKGMNAMNAAAFVPMMPAVNLTNQVAFSAPQTTASSNTQLTQQQQSLPQTNEHQRARTHSNANNHFTKTHHQGQRSHQRFVRA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of RU1C_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RU1C_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RU1C_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RU1C_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
JHD1_SCHPO | epe1 | genetic | 18818364 | |
YOI5_SCHPO | SPBC1778.05c | genetic | 22681890 | |
RICTR_SCHPO | ste20 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...