| UniProt ID | PIT1_HUMAN | |
|---|---|---|
| UniProt AC | P28069 | |
| Protein Name | Pituitary-specific positive transcription factor 1 | |
| Gene Name | POU1F1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 291 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Specifically binds to the consensus sequence 5'-TAAAT-3'. Activates growth hormone and prolactin genes. [PubMed: 22010633] | |
| Protein Sequence | MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 179 | Phosphorylation | RFENLQLSFKNACKL CCCCCCCHHHHHHHH | 22.63 | 24719451 | |
| 219 | Phosphorylation | ERKRKRRTTISIAAK HHHHCCCHHHHHHHH | 32.30 | - | |
| 274 | Phosphorylation | QREKRVKTSLNQSLF HHHHHHHHHHHHHHH | 35.27 | - | |
| 275 | Phosphorylation | REKRVKTSLNQSLFS HHHHHHHHHHHHHHH | 21.43 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIT1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIT1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIT1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GCR_HUMAN | NR3C1 | physical | 9426156 | |
| GATA2_HUMAN | GATA2 | physical | 10367888 | |
| NR1I2_HUMAN | NR1I2 | physical | 11891224 | |
| PPARG_HUMAN | PPARG | physical | 11891224 | |
| PPARA_HUMAN | PPARA | physical | 11891224 | |
| VDR_HUMAN | VDR | physical | 11891224 | |
| NR1I3_HUMAN | NR1I3 | physical | 11891224 | |
| MED1_HUMAN | MED1 | physical | 16396960 | |
| GATA2_HUMAN | GATA2 | physical | 16396960 | |
| NCOR1_HUMAN | NCOR1 | physical | 16030140 | |
| NCOR1_HUMAN | NCOR1 | physical | 9751061 | |
| CBP_HUMAN | CREBBP | physical | 9751061 | |
| CEBPD_HUMAN | CEBPD | physical | 21980073 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
