| UniProt ID | CEBPD_HUMAN | |
|---|---|---|
| UniProt AC | P49716 | |
| Protein Name | CCAAT/enhancer-binding protein delta | |
| Gene Name | CEBPD | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 269 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. [PubMed: 16397300 Important transcription factor regulating the expression of genes involved in immune and inflammatory responses] | |
| Protein Sequence | MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSAALFSLD ------CCCCCCCCC | 23.42 | 22814378 | |
| 25 | Phosphorylation | PAEPAPFYEPGRAGK CCCCCCCCCCCCCCC | 21.83 | 21945579 | |
| 57 | Phosphorylation | PAMYDDESAIDFSAY CCCCCCCCCCCHHHH | 37.20 | - | |
| 120 | Sumoylation | PAAPRLLKREPDWGD CCCCHHHHCCCCCCC | 60.34 | - | |
| 120 | Acetylation | PAAPRLLKREPDWGD CCCCHHHHCCCCCCC | 60.34 | 6993007 | |
| 120 | Sumoylation | PAAPRLLKREPDWGD CCCCHHHHCCCCCCC | 60.34 | 16397300 | |
| 133 | Phosphorylation | GDGDAPGSLLPAQVA CCCCCCCCCHHHHHH | 26.18 | 22210691 | |
| 156 | Phosphorylation | LAAAGQPTPPTSPEP HHHCCCCCCCCCCCC | 33.73 | 22210691 | |
| 159 | Phosphorylation | AGQPTPPTSPEPPRS CCCCCCCCCCCCCCC | 59.11 | 22210691 | |
| 166 | Phosphorylation | TSPEPPRSSPRQTPA CCCCCCCCCCCCCCC | 50.93 | 17081983 | |
| 167 | Phosphorylation | SPEPPRSSPRQTPAP CCCCCCCCCCCCCCC | 25.94 | 17081983 | |
| 171 | Phosphorylation | PRSSPRQTPAPGPAR CCCCCCCCCCCCCCC | 23.77 | - | |
| 191 | Phosphorylation | KRGPDRGSPEYRQRR CCCCCCCCHHHHHHH | 18.56 | 23927012 | |
| 194 | Phosphorylation | PDRGSPEYRQRRERN CCCCCHHHHHHHHHH | 18.54 | 24732914 | |
| 232 | Ubiquitination | ELSAENEKLHQRVEQ HHHHHHHHHHHHHHH | 63.95 | 33845483 | |
| 256 | Phosphorylation | QFFKQLPSPPFLPAA HHHHHCCCCCCCCCC | 54.52 | 21815630 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 57 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
| 167 | S | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
| 171 | T | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
| - | K | Ubiquitination | E3 ubiquitin ligase | FBXW7 | Q969H0 | PMID:24658274 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CEBPD_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CEBPD_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SMAD3_HUMAN | SMAD3 | physical | 12524424 | |
| SMAD4_HUMAN | SMAD4 | physical | 12524424 | |
| HDAC1_HUMAN | HDAC1 | physical | 18619497 | |
| HDAC3_HUMAN | HDAC3 | physical | 18619497 | |
| CBP_HUMAN | CREBBP | physical | 12857754 | |
| PIAS4_HUMAN | PIAS4 | physical | 18477566 | |
| FACD2_HUMAN | FANCD2 | physical | 20805509 | |
| IPO4_HUMAN | IPO4 | physical | 20805509 | |
| SPAG5_HUMAN | SPAG5 | physical | 20805509 | |
| TRI26_HUMAN | TRIM26 | physical | 20805509 | |
| UBR5_HUMAN | UBR5 | physical | 20805509 | |
| XPO1_HUMAN | XPO1 | physical | 20805509 | |
| HDAC1_HUMAN | HDAC1 | physical | 17910034 | |
| HDAC3_HUMAN | HDAC3 | physical | 17910034 | |
| HDAC4_HUMAN | HDAC4 | physical | 17910034 | |
| SIAH2_HUMAN | SIAH2 | physical | 22037769 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Sumoylation | |
| Reference | PubMed |
| "Functional role of NF-IL6beta and its sumoylation and acetylationmodifications in promoter activation of cyclooxygenase 2 gene."; Wang J.-M., Ko C.-Y., Chen L.-C., Wang W.-L., Chang W.-C.; Nucleic Acids Res. 34:217-231(2006). Cited for: SUMOYLATION AT LYS-120, AND MUTAGENESIS OF LYS-120. | |