UniProt ID | CEBPD_HUMAN | |
---|---|---|
UniProt AC | P49716 | |
Protein Name | CCAAT/enhancer-binding protein delta | |
Gene Name | CEBPD | |
Organism | Homo sapiens (Human). | |
Sequence Length | 269 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. [PubMed: 16397300 Important transcription factor regulating the expression of genes involved in immune and inflammatory responses] | |
Protein Sequence | MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSAALFSLD ------CCCCCCCCC | 23.42 | 22814378 | |
25 | Phosphorylation | PAEPAPFYEPGRAGK CCCCCCCCCCCCCCC | 21.83 | 21945579 | |
57 | Phosphorylation | PAMYDDESAIDFSAY CCCCCCCCCCCHHHH | 37.20 | - | |
120 | Sumoylation | PAAPRLLKREPDWGD CCCCHHHHCCCCCCC | 60.34 | - | |
120 | Acetylation | PAAPRLLKREPDWGD CCCCHHHHCCCCCCC | 60.34 | 6993007 | |
120 | Sumoylation | PAAPRLLKREPDWGD CCCCHHHHCCCCCCC | 60.34 | 16397300 | |
133 | Phosphorylation | GDGDAPGSLLPAQVA CCCCCCCCCHHHHHH | 26.18 | 22210691 | |
156 | Phosphorylation | LAAAGQPTPPTSPEP HHHCCCCCCCCCCCC | 33.73 | 22210691 | |
159 | Phosphorylation | AGQPTPPTSPEPPRS CCCCCCCCCCCCCCC | 59.11 | 22210691 | |
166 | Phosphorylation | TSPEPPRSSPRQTPA CCCCCCCCCCCCCCC | 50.93 | 17081983 | |
167 | Phosphorylation | SPEPPRSSPRQTPAP CCCCCCCCCCCCCCC | 25.94 | 17081983 | |
171 | Phosphorylation | PRSSPRQTPAPGPAR CCCCCCCCCCCCCCC | 23.77 | - | |
191 | Phosphorylation | KRGPDRGSPEYRQRR CCCCCCCCHHHHHHH | 18.56 | 23927012 | |
194 | Phosphorylation | PDRGSPEYRQRRERN CCCCCHHHHHHHHHH | 18.54 | 24732914 | |
232 | Ubiquitination | ELSAENEKLHQRVEQ HHHHHHHHHHHHHHH | 63.95 | 33845483 | |
256 | Phosphorylation | QFFKQLPSPPFLPAA HHHHHCCCCCCCCCC | 54.52 | 21815630 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
57 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
167 | S | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
171 | T | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
- | K | Ubiquitination | E3 ubiquitin ligase | FBXW7 | Q969H0 | PMID:24658274 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CEBPD_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CEBPD_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SMAD3_HUMAN | SMAD3 | physical | 12524424 | |
SMAD4_HUMAN | SMAD4 | physical | 12524424 | |
HDAC1_HUMAN | HDAC1 | physical | 18619497 | |
HDAC3_HUMAN | HDAC3 | physical | 18619497 | |
CBP_HUMAN | CREBBP | physical | 12857754 | |
PIAS4_HUMAN | PIAS4 | physical | 18477566 | |
FACD2_HUMAN | FANCD2 | physical | 20805509 | |
IPO4_HUMAN | IPO4 | physical | 20805509 | |
SPAG5_HUMAN | SPAG5 | physical | 20805509 | |
TRI26_HUMAN | TRIM26 | physical | 20805509 | |
UBR5_HUMAN | UBR5 | physical | 20805509 | |
XPO1_HUMAN | XPO1 | physical | 20805509 | |
HDAC1_HUMAN | HDAC1 | physical | 17910034 | |
HDAC3_HUMAN | HDAC3 | physical | 17910034 | |
HDAC4_HUMAN | HDAC4 | physical | 17910034 | |
SIAH2_HUMAN | SIAH2 | physical | 22037769 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Sumoylation | |
Reference | PubMed |
"Functional role of NF-IL6beta and its sumoylation and acetylationmodifications in promoter activation of cyclooxygenase 2 gene."; Wang J.-M., Ko C.-Y., Chen L.-C., Wang W.-L., Chang W.-C.; Nucleic Acids Res. 34:217-231(2006). Cited for: SUMOYLATION AT LYS-120, AND MUTAGENESIS OF LYS-120. |