UniProt ID | PEX7_HUMAN | |
---|---|---|
UniProt AC | O00628 | |
Protein Name | Peroxisomal targeting signal 2 receptor | |
Gene Name | PEX7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 323 | |
Subcellular Localization | Peroxisome. Cytoplasm. | |
Protein Description | Binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.. | |
Protein Sequence | MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWDTAKAAGPLQVYKEHAQEVYSVDWSQTRGEQLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPHIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLGHTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDSLLETVEHHTEFTCGLDFSLQSPTQVADCSWDETIKIYDPACLTIPA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
138 | Acetylation | GSWDQTVKLWDPTVG EECCCCEEEECCCCC | 47.44 | 7465771 | |
186 | Ubiquitination | TLRIWDVKAAGVRIV EEEEEEEEECCEEEE | 30.00 | 21890473 | |
186 | Ubiquitination | TLRIWDVKAAGVRIV EEEEEEEEECCEEEE | 30.00 | 21890473 | |
256 | Phosphorylation | KFSPFHASVLASCSY ECCCCCHHHHHHCCC | 14.75 | - | |
260 | Phosphorylation | FHASVLASCSYDFTV CCHHHHHHCCCEEEE | 10.23 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PEX7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEX7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEX7_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
614879 | Peroxisome biogenesis disorder complementation group 11 (PBD-CG11) | |||||
215100 | Rhizomelic chondrodysplasia punctata 1 (RCDP1) | |||||
614879 | Peroxisome biogenesis disorder 9B (PBD9B) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...