CF226_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CF226_HUMAN
• UniProt AC: Q5I0X4
• Protein Name: Uncharacterized protein C6orf226
• Gene Name: C6orf226
• Organism: Homo sapiens (Human).
• Sequence Length: 101
• Protein Sequence: MERPRSPQCSAPASASASVTLAQLLQLVQQGQELPGLEKRHIAAIHGEPTASRLPRRPKPWEAAALAESLPPPTLRIGTAPAEPGLVEAATAPSSWHTVGP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MERPRSPQCSAPA --CCCCCCCCCCCCC	23.23	25849741
10	Phosphorylation	RPRSPQCSAPASASA CCCCCCCCCCCCHHH	31.85	28450419
14	Phosphorylation	PQCSAPASASASVTL CCCCCCCCHHHHHHH	23.00	28450419
16	Phosphorylation	CSAPASASASVTLAQ CCCCCCHHHHHHHHH	20.69	28450419
18	Phosphorylation	APASASASVTLAQLL CCCCHHHHHHHHHHH	17.09	28450419
20	Phosphorylation	ASASASVTLAQLLQL CCHHHHHHHHHHHHH	17.55	28450419

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CF226_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CF226_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CF226_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
THIK_HUMAN	ACAA1	physical	28514442
PEX7_HUMAN	PEX7	physical	28514442
PAHX_HUMAN	PHYH	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.