UniProt ID | PEX13_HUMAN | |
---|---|---|
UniProt AC | Q92968 | |
Protein Name | Peroxisomal membrane protein PEX13 | |
Gene Name | PEX13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 403 | |
Subcellular Localization |
Peroxisome membrane Single-pass membrane protein . |
|
Protein Description | Component of the peroxisomal translocation machinery with PEX14 and PEX17. Functions as a docking factor for the predominantly cytoplasmic PTS1 receptor (PAS10/PEX5). Involved in the import of PTS1 and PTS2 proteins.. | |
Protein Sequence | MASQPPPPPKPWETRRIPGAGPGPGPGPTFQSADLGPTLMTRPGQPALTRVPPPILPRPSQQTGSSSVNTFRPAYSSFSSGYGAYGNSFYGGYSPYSYGYNGLGYNRLRVDDLPPSRFVQQAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSFRAVLDVANHFSRLKIHFTKVFSAFALVRTIRYLYRRLQRMLGLRRGSENEDLWAESEGTVACLGAEDRAATSAKSWPIFLFFAVILGGPYLIWKLLSTHSDEVTDSINWASGEDDHVVARAEYDFAAVSEEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRKGRKTVESSKVSKQQQSFTNPTLTKGATVADSLDEQEAAFESVFVETNKVPVAPDSIGKDGEKQDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
82 | Phosphorylation | YSSFSSGYGAYGNSF CHHHCCCCCCCCCCC | 10.67 | - | |
98 | Phosphorylation | GGYSPYSYGYNGLGY CCCCCCCCCCCCCCC | 20.13 | - | |
100 | Phosphorylation | YSPYSYGYNGLGYNR CCCCCCCCCCCCCCC | 9.60 | - | |
172 | Ubiquitination | ANHFSRLKIHFTKVF HHHHHHCCCHHHHHH | 32.78 | 33845483 | |
205 | Phosphorylation | MLGLRRGSENEDLWA HHCCCCCCCCCCCCC | 35.12 | 25849741 | |
304 | Ubiquitination | DMLNLALKEQQPKVR HHHHHHHHHHCCCCC | 48.12 | 22817900 | |
309 | Ubiquitination | ALKEQQPKVRGWLLA HHHHHCCCCCCEEEE | 39.98 | 22817900 | |
338 | Ubiquitination | VKILGKRKGRKTVES HHHHCCCCCCCCCHH | 67.56 | - | |
341 | Ubiquitination | LGKRKGRKTVESSKV HCCCCCCCCCHHHCC | 66.64 | - | |
347 | Ubiquitination | RKTVESSKVSKQQQS CCCCHHHCCCHHHHC | 60.86 | 33845483 | |
350 | Ubiquitination | VESSKVSKQQQSFTN CHHHCCCHHHHCCCC | 55.93 | 33845483 | |
354 | Phosphorylation | KVSKQQQSFTNPTLT CCCHHHHCCCCCCCC | 29.69 | 28555341 | |
365 | Phosphorylation | PTLTKGATVADSLDE CCCCCCCCCCCCCCH | 25.54 | - | |
393 | Phosphorylation | KVPVAPDSIGKDGEK CCCCCCCCCCCCCCC | 31.98 | 21815630 | |
396 | Ubiquitination | VAPDSIGKDGEKQDL CCCCCCCCCCCCCCC | 61.97 | 33845483 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PEX13_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEX13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEX13_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PEX5_HUMAN | PEX5 | physical | 8858165 | |
PEX5_HUMAN | PEX5 | physical | 11865044 | |
PEX7_HUMAN | PEX7 | physical | 11865044 | |
PEX14_HUMAN | PEX14 | physical | 11865044 | |
PEX13_HUMAN | PEX13 | physical | 12096124 | |
PEX19_HUMAN | PEX19 | physical | 12096124 | |
SPR2A_HUMAN | SPRR2A | physical | 18155796 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00205 | Zellweger syndrome spectrum, including: Zellweger syndrome (ZS); Adrenoleukodystrophy, neonatal (NAL | |||||
OMIM Disease | ||||||
614883 | Peroxisome biogenesis disorder complementation group 13 (PBD-CG13) | |||||
614883 | Peroxisome biogenesis disorder 11A (PBD11A) | |||||
614885 | Peroxisome biogenesis disorder 11B (PBD11B) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...