SPR2A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPR2A_HUMAN
• UniProt AC: P35326
• Protein Name: Small proline-rich protein 2A
• Gene Name: SPRR2A
• Organism: Homo sapiens (Human).
• Sequence Length: 72
• Subcellular Localization: Cytoplasm.
• Protein Description: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane..
• Protein Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Phosphorylation	QPPPVCPTPKCPEPC CCCCCCCCCCCCCCC	30.19	25072903
54	Phosphorylation	PQQCQQKYPPVTPSP HHHHHHCCCCCCCCC	14.39	29759185
58	Phosphorylation	QQKYPPVTPSPPCQS HHCCCCCCCCCCCCC	24.67	29759185
60	Phosphorylation	KYPPVTPSPPCQSKY CCCCCCCCCCCCCCC	31.91	27966365
65	Phosphorylation	TPSPPCQSKYPPKSK CCCCCCCCCCCCCCC	40.65	29759185

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPR2A_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPR2A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPR2A_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARL3_HUMAN	ARL3	physical	27173435

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.