PAEP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PAEP_HUMAN
• UniProt AC: P09466
• Protein Name: Glycodelin
• Gene Name: PAEP
• Organism: Homo sapiens (Human).
• Sequence Length: 180
• Subcellular Localization: Secreted .
• Protein Description: Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities. [PubMed: 9918684]
• Protein Sequence: MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
46	N-linked_Glycosylation	SMAMATNNISLMATL HHHHHCCCEEEEEEC	22.37	7592613
67	Phosphorylation	HITSLLPTPEDNLEI EEEEECCCCHHCEEE	39.00	26853621
81	N-linked_Glycosylation	IVLHRWENNSCVEKK EEEEEEECCCCEEEE	38.46	7592613
98	Acetylation	GEKTENPKKFKINYT CCCCCCCCCEEEEEE	80.54	19813141

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PAEP_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PAEP_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PAEP_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CSN6_HUMAN	COPS6	physical	16169070
IGS21_HUMAN	IGSF21	physical	16169070
LRIF1_HUMAN	LRIF1	physical	16169070
EF1A1_HUMAN	EEF1A1	physical	16169070
XRCC6_HUMAN	XRCC6	physical	16169070
A4_HUMAN	APP	physical	21832049
GRM2B_HUMAN	GRAMD3	physical	25416956
OST48_HUMAN	DDOST	physical	26496610
TF3C2_HUMAN	GTF3C2	physical	26496610
UBL4A_HUMAN	UBL4A	physical	26496610
CMC1_HUMAN	SLC25A12	physical	26496610
DNJB5_HUMAN	DNAJB5	physical	26496610
ESYT2_HUMAN	ESYT2	physical	26496610
ZFP91_HUMAN	ZFP91	physical	26496610

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.