UniProt ID | PAEP_HUMAN | |
---|---|---|
UniProt AC | P09466 | |
Protein Name | Glycodelin | |
Gene Name | PAEP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 180 | |
Subcellular Localization | Secreted . | |
Protein Description | Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities. [PubMed: 9918684] | |
Protein Sequence | MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | N-linked_Glycosylation | SMAMATNNISLMATL HHHHHCCCEEEEEEC | 22.37 | 7592613 | |
67 | Phosphorylation | HITSLLPTPEDNLEI EEEEECCCCHHCEEE | 39.00 | 26853621 | |
81 | N-linked_Glycosylation | IVLHRWENNSCVEKK EEEEEEECCCCEEEE | 38.46 | 7592613 | |
98 | Acetylation | GEKTENPKKFKINYT CCCCCCCCCEEEEEE | 80.54 | 19813141 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAEP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAEP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAEP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CSN6_HUMAN | COPS6 | physical | 16169070 | |
IGS21_HUMAN | IGSF21 | physical | 16169070 | |
LRIF1_HUMAN | LRIF1 | physical | 16169070 | |
EF1A1_HUMAN | EEF1A1 | physical | 16169070 | |
XRCC6_HUMAN | XRCC6 | physical | 16169070 | |
A4_HUMAN | APP | physical | 21832049 | |
GRM2B_HUMAN | GRAMD3 | physical | 25416956 | |
OST48_HUMAN | DDOST | physical | 26496610 | |
TF3C2_HUMAN | GTF3C2 | physical | 26496610 | |
UBL4A_HUMAN | UBL4A | physical | 26496610 | |
CMC1_HUMAN | SLC25A12 | physical | 26496610 | |
DNJB5_HUMAN | DNAJB5 | physical | 26496610 | |
ESYT2_HUMAN | ESYT2 | physical | 26496610 | |
ZFP91_HUMAN | ZFP91 | physical | 26496610 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...