UniProt ID | NFYA_MOUSE | |
---|---|---|
UniProt AC | P23708 | |
Protein Name | Nuclear transcription factor Y subunit alpha | |
Gene Name | Nfya | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 346 | |
Subcellular Localization | Nucleus. | |
Protein Description | Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors. NF-YA positively regulates the transcription of the core clock component ARNTL/BMAL1.. | |
Protein Sequence | MEQYTTNSNSSTEQIVVQAGQIQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
265 | Phosphorylation | MLEEEPLYVNAKQYH HHCCCCCCCCHHHHH | 11.45 | 28725479 | |
283 | Acetylation | KRRQARAKLEAEGKI HHHHHHHHHHHCCCC | 41.11 | 18815279 | |
283 | Ubiquitination | KRRQARAKLEAEGKI HHHHHHHHHHHCCCC | 41.11 | - | |
289 | Acetylation | AKLEAEGKIPKERRK HHHHHCCCCCHHHHH | 47.54 | 18815279 | |
289 | Ubiquitination | AKLEAEGKIPKERRK HHHHHCCCCCHHHHH | 47.54 | - | |
292 | Ubiquitination | EAEGKIPKERRKYLH HHCCCCCHHHHHHHH | 68.29 | - | |
296 | Ubiquitination | KIPKERRKYLHESRH CCCHHHHHHHHHHHH | 59.39 | - | |
319 | Phosphorylation | GEGGRFFSPKEKDSP CCCCCCCCCCCCCCC | 32.14 | 29514104 | |
325 | Phosphorylation | FSPKEKDSPHMQDPN CCCCCCCCCCCCCCC | 27.98 | 25521595 | |
340 | Phosphorylation | QADEEAMTQIIRVS- HHCHHHHHHHHCCC- | 24.54 | 23984901 | |
346 | Phosphorylation | MTQIIRVS------- HHHHHCCC------- | 25.34 | 25338131 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NFYA_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NFYA_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NFYA_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CREB1_MOUSE | Creb1 | physical | 17226765 | |
STF1_MOUSE | Nr5a1 | physical | 20211142 | |
RPB1_MOUSE | Polr2a | physical | 15601870 | |
TBP_MOUSE | Tbp | physical | 21705419 | |
STF1_MOUSE | Nr5a1 | physical | 12730328 | |
NFYB_HUMAN | NFYB | physical | 26496610 | |
NFYC_HUMAN | NFYC | physical | 26496610 | |
SFSWA_HUMAN | SFSWAP | physical | 26496610 | |
ZNF3_HUMAN | ZNF3 | physical | 26496610 | |
MOT4_HUMAN | SLC16A3 | physical | 26496610 | |
NS1BP_HUMAN | IVNS1ABP | physical | 26496610 | |
RM03_HUMAN | MRPL3 | physical | 26496610 | |
LRCH1_HUMAN | LRCH1 | physical | 26496610 | |
S18L2_HUMAN | SS18L2 | physical | 26496610 | |
DGCR8_HUMAN | DGCR8 | physical | 26496610 | |
HMCES_HUMAN | HMCES | physical | 26496610 | |
SFXN3_HUMAN | SFXN3 | physical | 26496610 | |
OSBL1_HUMAN | OSBPL1A | physical | 26496610 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...