UniProt ID | S18L2_HUMAN | |
---|---|---|
UniProt AC | Q9UHA2 | |
Protein Name | SS18-like protein 2 | |
Gene Name | SS18L2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 77 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIADASPTSTSKAME | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Ubiquitination | VPDWLRGKAEVNQET CCHHHCCCHHCCHHH | 34.63 | 21906983 | |
41 | Ubiquitination | CIVEYQNKGRGNECV HHHHHHCCCCCCCCH | 34.16 | - | |
50 | Phosphorylation | RGNECVQYQHVLHRN CCCCCHHHHHHHHHC | 4.72 | - | |
60 | Phosphorylation | VLHRNLIYLATIADA HHHHCHHHHHHHCCC | 8.08 | 21214269 | |
63 | Phosphorylation | RNLIYLATIADASPT HCHHHHHHHCCCCCC | 17.69 | 28122231 | |
68 | Phosphorylation | LATIADASPTSTSKA HHHHCCCCCCCCHHH | 29.29 | 28122231 | |
70 | Phosphorylation | TIADASPTSTSKAME HHCCCCCCCCHHHCC | 41.99 | 21214269 | |
71 | Phosphorylation | IADASPTSTSKAME- HCCCCCCCCHHHCC- | 33.78 | 28122231 | |
72 | Phosphorylation | ADASPTSTSKAME-- CCCCCCCCHHHCC-- | 36.40 | 28122231 | |
73 | Phosphorylation | DASPTSTSKAME--- CCCCCCCHHHCC--- | 20.41 | 28122231 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S18L2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S18L2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S18L2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of S18L2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...