MZT1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MZT1_MOUSE
• UniProt AC: Q8BUR9
• Protein Name: Mitotic-spindle organizing protein 1
• Gene Name: Mzt1
• Organism: Mus musculus (Mouse).
• Sequence Length: 78
• Subcellular Localization: Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Cytoplasm, cytoskeleton, spindle .
• Protein Description: Required for gamma-tubulin complex recruitment to the centrosome..
• Protein Sequence: MASGSGPGAAASANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKGTEALKAAENTS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MASGSGPGA ------CCCCCCCCH	23.69	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MZT1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MZT1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MZT1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LG3BP_HUMAN	LGALS3BP	physical	20360068
GCP5_HUMAN	TUBGCP5	physical	20360068
TBG1_HUMAN	TUBG1	physical	20360068
GCP3_HUMAN	TUBGCP3	physical	20360068
GCP4_HUMAN	TUBGCP4	physical	20360068
MZT1_HUMAN	MZT1	physical	20360068
MZT2A_HUMAN	MZT2A	physical	20360068
GCP2_HUMAN	TUBGCP2	physical	20360068
GCP6_HUMAN	TUBGCP6	physical	20360068
NEDD1_HUMAN	NEDD1	physical	20360068

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.