UniProt ID | MZT1_MOUSE | |
---|---|---|
UniProt AC | Q8BUR9 | |
Protein Name | Mitotic-spindle organizing protein 1 | |
Gene Name | Mzt1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 78 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Cytoplasm, cytoskeleton, spindle . | |
Protein Description | Required for gamma-tubulin complex recruitment to the centrosome.. | |
Protein Sequence | MASGSGPGAAASANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKGTEALKAAENTS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASGSGPGA ------CCCCCCCCH | 23.69 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MZT1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MZT1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MZT1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LG3BP_HUMAN | LGALS3BP | physical | 20360068 | |
GCP5_HUMAN | TUBGCP5 | physical | 20360068 | |
TBG1_HUMAN | TUBG1 | physical | 20360068 | |
GCP3_HUMAN | TUBGCP3 | physical | 20360068 | |
GCP4_HUMAN | TUBGCP4 | physical | 20360068 | |
MZT1_HUMAN | MZT1 | physical | 20360068 | |
MZT2A_HUMAN | MZT2A | physical | 20360068 | |
GCP2_HUMAN | TUBGCP2 | physical | 20360068 | |
GCP6_HUMAN | TUBGCP6 | physical | 20360068 | |
NEDD1_HUMAN | NEDD1 | physical | 20360068 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...