UniProt ID | LRC46_HUMAN | |
---|---|---|
UniProt AC | Q96FV0 | |
Protein Name | Leucine-rich repeat-containing protein 46 | |
Gene Name | LRRC46 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 321 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSGGKSAQGPEEGGVCITEALITKRNLTFPEDGELSEKMFHTLDELQTVRLDREGITTIRNLEGLQNLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSENLIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSDEEFPELSGPFCSERGFLKELEQELSRHREHRQQTALTEHLLRMEMQPTLTDLPLLPGVPMAGDSSPSATPAQGEETVPEAVSSPQASSPTKKPCSLIPRGHQSSFWGRKGARAATAPKASVAEAPSTTKTTAKRSKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Ubiquitination | ITEALITKRNLTFPE EEEHHHCCCCCCCCC | 32.09 | 29967540 | |
42 | Phosphorylation | LSEKMFHTLDELQTV CCHHHCCCHHHHHHH | 25.33 | 27794612 | |
72 | Phosphorylation | LQNLHSLYLQGNKIQ HHHHHHHHHCCCCCH | 10.45 | 22817900 | |
89 | Phosphorylation | ENLACIPSLRFLSLA HHHHCCCHHHHHHHC | 16.56 | 24719451 | |
175 | Phosphorylation | PVVERWISDEEDEAS EEEEEECCCCCCCCC | 31.82 | - | |
182 | Phosphorylation | SDEEDEASSDEEFPE CCCCCCCCCCCCCHH | 35.95 | - | |
299 | Phosphorylation | RKGARAATAPKASVA CCCCCCCCCCCCHHH | 42.37 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LRC46_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LRC46_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LRC46_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...