ID2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ID2_MOUSE
• UniProt AC: P41136
• Protein Name: DNA-binding protein inhibitor ID-2
• Gene Name: Id2
• Organism: Mus musculus (Mouse).
• Sequence Length: 134
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Restricts the CLOCK and ARNTL/BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock: in the input component, is involved in modulating the magnitude of photic entrainment and in the output component, contributes to the regulation of a variety of liver clock-controlled genes involved in lipid metabolism..
• Protein Sequence: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MKAFSPVRSVRK ---CCCCCCCCHHHC	27.61	21183079
14	Phosphorylation	VRSVRKNSLSDHSLG CCHHHCCCCCCCCCC	32.08	26824392
16	Phosphorylation	SVRKNSLSDHSLGIS HHHCCCCCCCCCCCC	32.85	28066266
25	Phosphorylation	HSLGISRSKTPVDDP CCCCCCCCCCCCCCH	33.81	25266776
27	Phosphorylation	LGISRSKTPVDDPMS CCCCCCCCCCCCHHH	29.77	26643407
34	Phosphorylation	TPVDDPMSLLYNMND CCCCCHHHHHHHHHH	22.17	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
27	T	Phosphorylation	Kinase	DYRK1A	Q13627	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ID2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ID2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ID2_MOUSE	Id2	physical	10891368
MYOD1_MOUSE	Myod1	physical	20211142
RB_MOUSE	Rb1	physical	20211142
SPI1_MOUSE	Spi1	physical	20211142
UBP1_MOUSE	Usp1	physical	24573694
TFE2_MOUSE	Tcf3	physical	23395635
PGBM_HUMAN	HSPG2	physical	26496610
TFE2_HUMAN	TCF3	physical	26496610
HTF4_HUMAN	TCF12	physical	26496610
SYMPK_HUMAN	SYMPK	physical	26496610
CPSF5_HUMAN	NUDT21	physical	26496610
APOL2_HUMAN	APOL2	physical	26496610
THOC2_HUMAN	THOC2	physical	26496610
RBM26_HUMAN	RBM26	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.