UniProt ID | HLAG_HUMAN | |
---|---|---|
UniProt AC | P17693 | |
Protein Name | HLA class I histocompatibility antigen, alpha chain G | |
Gene Name | HLA-G | |
Organism | Homo sapiens (Human). | |
Sequence Length | 338 | |
Subcellular Localization |
Isoform 1: Cell membrane Single-pass type I membrane protein . Isoform 2: Cell membrane Single-pass type I membrane protein . Isoform 3: Cell membrane Single-pass type I membrane protein . Isoform 4: Cell membrane Single-pass type I membrane pr |
|
Protein Description | Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.. | |
Protein Sequence | MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Phosphorylation | LLLSGALTLTETWAG HHHHCCHHHCCCCCC | 30.97 | 22210691 | |
110 | N-linked_Glycosylation | QTLRGYYNQSEASSH HHHHHHCCHHHHCCC | 30.34 | 9637505 | |
110 | N-linked_Glycosylation | QTLRGYYNQSEASSH HHHHHHCCHHHHCCC | 30.34 | 9637505 | |
167 | Phosphorylation | ADTAAQISKRKCEAA HHHHHHHHHHHHHHC | 17.83 | - | |
183 | Phosphorylation | VAEQRRAYLEGTCVE HHHHHHHHHHCCHHH | 11.95 | - | |
267 | Ubiquitination | AGDGTFQKWAAVVVP CCCCCEEEEEEEEEC | 34.31 | 2190698 | |
275 | Phosphorylation | WAAVVVPSGEEQRYT EEEEEECCCCCEEEE | 47.42 | - | |
281 | Phosphorylation | PSGEEQRYTCHVQHE CCCCCEEEEEEEEEC | 17.26 | - | |
323 | Phosphorylation | VVLAAVVTGAAVAAV HHHHHHHHHHHHHHH | 17.95 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HLAG_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HLAG_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HLAG_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HLAG_HUMAN | HLA-G | physical | 12874224 | |
COPB_HUMAN | COPB1 | physical | 12582157 | |
CD8A_HUMAN | CD8A | physical | 10809759 | |
HLAG_HUMAN | HLA-G | physical | 12454284 | |
CD8A_HUMAN | CD8A | physical | 1908512 | |
1C07_HUMAN | HLA-C | physical | 28514442 | |
1A02_HUMAN | HLA-A | physical | 28514442 | |
1A03_HUMAN | HLA-A | physical | 28514442 | |
1A01_HUMAN | HLA-A | physical | 28514442 | |
1A26_HUMAN | HLA-A | physical | 28514442 | |
HLAF_HUMAN | HLA-F | physical | 28514442 | |
1B07_HUMAN | HLA-B | physical | 28514442 | |
1B18_HUMAN | HLA-B | physical | 28514442 | |
HLAE_HUMAN | HLA-E | physical | 28514442 | |
F213A_HUMAN | FAM213A | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00344 | Leprosy; Hansen disease | |||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...